Psyllid ID: psy1680


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
YGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGPNRSNSMNDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL
ccccccccccccccEEEEccccccccHHHHHHHcccccEEEEEEcccccccccccEEEEEEccHHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEccHHHHHHHHHHccccccccc
cccccccccccccEEEEEEcccccccHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHccccEEEcccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccccccccEEEEEEccHHHHHHHHHcccEEEEccc
ygrnqktlpteppytafvgnlpngitqgdverffpeqkLVSVRLVKdketdrfkgfcyveFVDVENLRQALLkdgritvdglqvrldiadgkrndnkggfnnkqnrgggsggmggnkynqhqggsfnrdnmrnnsrgggassgggfndfsrggegpggfrnnngpnrsnsmndhglmVTEVTTLVSVRLVKdketdrfkgfcyveFVDVENLRQALLkdgritvdgl
ygrnqktlpteppytafVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALlkdgritvdglqvrldiadgkrndnkggfnnkqnrgggsggmGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGPNRSNSMNDHGLMVTEVTTLVSVRLVkdketdrfkgfcyvefvdvenlrqallkdgritvdgl
YGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRgggsggmggNKYNQHQGGSFNRDNMRNNsrgggassgggFNDfsrggegpggfrnnngpnrsnsmnDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL
*************YTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIA*************************************************************************************GLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRI*****
******T****PPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRL******************************************DNMRNNSRGGGASSGGGFNDFSRG******************************************TDRFKGFCYVEFVDVENLRQALLKDGRITVDG*
YGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGPNRSNSMNDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL
****QKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIAD**********************************************************************************DHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGPNRSNSMNDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query227 2.2.26 [Sep-21-2011]
Q5XI72248 Eukaryotic translation in yes N/A 0.696 0.637 0.435 3e-25
Q9WUK2248 Eukaryotic translation in yes N/A 0.696 0.637 0.435 4e-25
Q15056248 Eukaryotic translation in yes N/A 0.696 0.637 0.429 3e-24
Q5RBR8228 Eukaryotic translation in yes N/A 0.409 0.407 0.553 9e-24
Q1JPH6228 Eukaryotic translation in yes N/A 0.409 0.407 0.553 1e-23
O14369388 Probable RNA-binding prot yes N/A 0.405 0.237 0.414 1e-10
Q04836329 31 kDa ribonucleoprotein, yes N/A 0.361 0.249 0.349 2e-07
Q9FVQ1557 Nucleolin 1 OS=Arabidopsi no N/A 0.612 0.249 0.324 2e-07
Q8BGD9 611 Eukaryotic translation in no N/A 0.361 0.134 0.369 2e-07
P23588 611 Eukaryotic translation in no N/A 0.361 0.134 0.357 5e-07
>sp|Q5XI72|IF4H_RAT Eukaryotic translation initiation factor 4H OS=Rattus norvegicus GN=Eif4h PE=1 SV=1 Back     alignment and function desciption
 Score =  115 bits (287), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 100/163 (61%), Gaps = 5/163 (3%)

Query: 3   RNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFV 62
           R+QK LPTEPPYTA+VGNLP    QGD++  F +  + SVRLV+DK+TD+FKGFCYVEF 
Sbjct: 31  RSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFD 90

Query: 63  DVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQ 122
           +V++L++AL  DG +  D   +R+DIA+G++ D  G     +  G    GMGG++  + +
Sbjct: 91  EVDSLKEALTYDGALLGD-RSLRVDIAEGRKQDKGG--FGFRKGGPDDRGMGGSR--EPR 145

Query: 123 GGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGP 165
           GG  +RD+  +  R       GG     R    P G R  +GP
Sbjct: 146 GGWDSRDDFSSGYRDDFLGGRGGSRPGDRRAGPPMGSRFRDGP 188




Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA.
Rattus norvegicus (taxid: 10116)
>sp|Q9WUK2|IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus GN=Eif4h PE=1 SV=3 Back     alignment and function description
>sp|Q15056|IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens GN=EIF4H PE=1 SV=5 Back     alignment and function description
>sp|Q5RBR8|IF4H_PONAB Eukaryotic translation initiation factor 4H OS=Pongo abelii GN=EIF4H PE=2 SV=1 Back     alignment and function description
>sp|Q1JPH6|IF4H_BOVIN Eukaryotic translation initiation factor 4H OS=Bos taurus GN=EIF4H PE=2 SV=1 Back     alignment and function description
>sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 Back     alignment and function description
>sp|Q04836|ROC3_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=RBP31 PE=1 SV=1 Back     alignment and function description
>sp|Q9FVQ1|NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana GN=NUCL1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BGD9|IF4B_MOUSE Eukaryotic translation initiation factor 4B OS=Mus musculus GN=Eif4b PE=1 SV=1 Back     alignment and function description
>sp|P23588|IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
380027391270 PREDICTED: eukaryotic translation initia 0.440 0.370 0.613 1e-28
48103761274 PREDICTED: eukaryotic translation initia 0.440 0.364 0.613 2e-28
340722741280 PREDICTED: eukaryotic translation initia 0.418 0.339 0.610 5e-27
350424096278 PREDICTED: eukaryotic translation initia 0.414 0.338 0.606 2e-26
332022959285 Eukaryotic translation initiation factor 0.405 0.322 0.586 7e-26
345484780277 PREDICTED: eukaryotic translation initia 0.405 0.332 0.586 9e-26
383858995286 PREDICTED: eukaryotic translation initia 0.396 0.314 0.6 1e-25
346468341273 hypothetical protein [Amblyomma maculatu 0.444 0.369 0.529 5e-25
307203767249 Eukaryotic translation initiation factor 0.409 0.373 0.580 8e-25
198468371 368 GA18178, isoform A [Drosophila pseudoobs 0.409 0.252 0.610 2e-24
>gi|380027391|ref|XP_003697409.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Apis florea] Back     alignment and taxonomy information
 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (0%)

Query: 1   YGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVE 60
           Y   +K LPTEPPYTAFVGNLPNGI QGDV++ F +  +  +RLVKDKETDRFKGFCYVE
Sbjct: 17  YRSGRKPLPTEPPYTAFVGNLPNGIVQGDVDKIFKKLNVKGIRLVKDKETDRFKGFCYVE 76

Query: 61  FVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFN 101
           F D+ +L  AL  DG + VD   +++D+A+GKRND +GGF+
Sbjct: 77  FEDLADLEAALEMDGAVEVDKSVIKIDVAEGKRND-RGGFD 116




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|48103761|ref|XP_392894.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340722741|ref|XP_003399761.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424096|ref|XP_003493687.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332022959|gb|EGI63225.1| Eukaryotic translation initiation factor 4H [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345484780|ref|XP_001599359.2| PREDICTED: eukaryotic translation initiation factor 4H-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383858995|ref|XP_003704984.1| PREDICTED: eukaryotic translation initiation factor 4H-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|346468341|gb|AEO34015.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|307203767|gb|EFN82710.1| Eukaryotic translation initiation factor 4H [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|198468371|ref|XP_001354678.2| GA18178, isoform A [Drosophila pseudoobscura pseudoobscura] gi|198146383|gb|EAL31733.2| GA18178, isoform A [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
FB|FBgn0262734 358 Rbp2 "RNA-binding protein 2" [ 0.427 0.270 0.585 2.5e-26
UNIPROTKB|E1BZH4254 LOC100859865 "Uncharacterized 0.422 0.377 0.581 3.2e-26
UNIPROTKB|F1NYA2146 LOC100859865 "Uncharacterized 0.422 0.657 0.581 3.2e-26
UNIPROTKB|A7MBG9222 WBSCR1 "WBSCR1 protein" [Bos t 0.422 0.432 0.571 3.2e-26
UNIPROTKB|Q1JPH6228 EIF4H "Eukaryotic translation 0.422 0.421 0.571 3.2e-26
UNIPROTKB|E2RQG8251 EIF4H "Uncharacterized protein 0.422 0.382 0.571 3.2e-26
UNIPROTKB|Q15056248 EIF4H "Eukaryotic translation 0.422 0.387 0.571 3.2e-26
UNIPROTKB|I3L594228 EIF4H "Uncharacterized protein 0.422 0.421 0.571 3.2e-26
UNIPROTKB|I3LRD5248 EIF4H "Uncharacterized protein 0.422 0.387 0.571 3.2e-26
MGI|MGI:1341822248 Eif4h "eukaryotic translation 0.422 0.387 0.571 3.2e-26
FB|FBgn0262734 Rbp2 "RNA-binding protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 58/99 (58%), Positives = 74/99 (74%)

Query:     3 RNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFV 62
             R  K LPTEPP+ AFVGNLP G+ QGDV + F + ++  VRLVKD+ETD+FKGFCYVEF 
Sbjct:    18 RASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLVKDRETDQFKGFCYVEFE 77

Query:    63 DVENLRQALLKDGRITVDGLQ--VRLDIADGKRNDNKGG 99
              ++NL +AL  DGRI +D L   +R+DIAD ++ND  GG
Sbjct:    78 TLDNLERALECDGRIKLDDLSAPLRIDIADRRKNDRPGG 116


GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0006413 "translational initiation" evidence=ISS
GO:0005829 "cytosol" evidence=ISS
GO:0003743 "translation initiation factor activity" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|E1BZH4 LOC100859865 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYA2 LOC100859865 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBG9 WBSCR1 "WBSCR1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JPH6 EIF4H "Eukaryotic translation initiation factor 4H" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQG8 EIF4H "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15056 EIF4H "Eukaryotic translation initiation factor 4H" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L594 EIF4H "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRD5 EIF4H "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1341822 Eif4h "eukaryotic translation initiation factor 4H" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9WUK2IF4H_MOUSENo assigned EC number0.43550.69600.6370yesN/A
Q5XI72IF4H_RATNo assigned EC number0.43550.69600.6370yesN/A
Q5RBR8IF4H_PONABNo assigned EC number0.55310.40960.4078yesN/A
Q1JPH6IF4H_BOVINNo assigned EC number0.55310.40960.4078yesN/A
Q15056IF4H_HUMANNo assigned EC number0.42940.69600.6370yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 1e-31
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 3e-15
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 2e-14
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 1e-13
smart0036073 smart00360, RRM, RNA recognition motif 2e-13
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-12
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-11
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 4e-11
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 5e-11
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 8e-11
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 1e-10
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-10
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 4e-10
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-09
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-09
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-09
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 2e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 8e-08
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-07
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 5e-07
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 6e-07
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 7e-07
smart0036073 smart00360, RRM, RNA recognition motif 1e-06
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-06
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-06
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-06
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 4e-06
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 4e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 5e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 6e-06
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 8e-06
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-05
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-05
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-05
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 3e-05
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 4e-05
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 4e-05
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 6e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 6e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 6e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 9e-05
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-04
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-04
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 2e-04
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-04
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-04
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 3e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 3e-04
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 3e-04
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 4e-04
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 4e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 5e-04
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 5e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 5e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 6e-04
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 7e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 8e-04
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 9e-04
cd1251473 cd12514, RRM4_RBM12_like, RNA recognition motif 4 9e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 0.001
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 0.001
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 0.001
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 0.001
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.001
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 0.002
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.002
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.002
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 0.002
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 0.002
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.002
cd1253785 cd12537, RRM1_RBM23, RNA recognition motif 1 in ve 0.002
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 0.002
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 0.003
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 0.004
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 0.004
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
 Score =  110 bits (277), Expect = 1e-31
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 1/77 (1%)

Query: 13 PYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALL 72
          P+TAFVGNLP    QGD++  F +  + SVRLV+DKETD+FKGFCYVEF DVE+L++AL 
Sbjct: 1  PFTAFVGNLPFNTVQGDLDAIFKDLSVKSVRLVRDKETDKFKGFCYVEFEDVESLKEALE 60

Query: 73 KDGRITVDGLQVRLDIA 89
           DG +  D   +R+DIA
Sbjct: 61 YDGAL-FDDRSLRVDIA 76


This subfamily corresponds to the RRM of eIF-4H, also termed Williams-Beuren syndrome chromosomal region 1 protein, which, together with elf-4B/eIF-4G, serves as the accessory protein of RNA helicase eIF-4A. eIF-4H contains a well conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). It stimulates protein synthesis by enhancing the helicase activity of eIF-4A in the initiation step of mRNA translation. . Length = 76

>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 227
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.97
KOG0148|consensus321 99.97
KOG0144|consensus 510 99.97
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.97
KOG0145|consensus360 99.96
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.96
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.95
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.95
KOG0131|consensus203 99.95
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.95
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.95
KOG0127|consensus 678 99.95
KOG0117|consensus 506 99.94
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.94
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.94
KOG0127|consensus 678 99.93
KOG0109|consensus 346 99.92
KOG0117|consensus 506 99.91
KOG0147|consensus 549 99.9
KOG0124|consensus 544 99.9
KOG0123|consensus 369 99.88
KOG0110|consensus725 99.87
KOG0105|consensus241 99.87
KOG4205|consensus 311 99.86
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.86
KOG0146|consensus371 99.84
KOG0144|consensus 510 99.84
KOG0123|consensus 369 99.82
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.81
KOG4206|consensus221 99.79
KOG0148|consensus 321 99.79
KOG1457|consensus284 99.76
KOG0147|consensus549 99.75
KOG4211|consensus 510 99.75
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.74
KOG4212|consensus 608 99.72
KOG1548|consensus382 99.68
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.68
KOG0106|consensus216 99.68
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.65
KOG0110|consensus 725 99.65
KOG0149|consensus247 99.64
KOG0121|consensus153 99.63
KOG0120|consensus500 99.63
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.63
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.61
KOG0122|consensus270 99.61
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.61
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.6
KOG0122|consensus270 99.58
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.58
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.57
KOG0149|consensus 247 99.57
KOG0126|consensus219 99.54
KOG0124|consensus 544 99.54
PLN03120260 nucleic acid binding protein; Provisional 99.53
KOG0113|consensus 335 99.52
KOG0113|consensus335 99.51
KOG0121|consensus153 99.51
KOG4207|consensus 256 99.51
KOG0125|consensus 376 99.5
KOG0107|consensus195 99.5
KOG4207|consensus256 99.5
KOG1190|consensus492 99.49
PLN03120 260 nucleic acid binding protein; Provisional 99.49
KOG4212|consensus 608 99.48
PLN03121243 nucleic acid binding protein; Provisional 99.46
KOG4211|consensus 510 99.45
KOG0114|consensus124 99.44
smart0036170 RRM_1 RNA recognition motif. 99.44
KOG0114|consensus124 99.43
PLN03213 759 repressor of silencing 3; Provisional 99.43
KOG0126|consensus 219 99.43
smart0036272 RRM_2 RNA recognition motif. 99.42
PLN03121 243 nucleic acid binding protein; Provisional 99.41
KOG0107|consensus 195 99.41
KOG0125|consensus376 99.41
smart0036272 RRM_2 RNA recognition motif. 99.41
smart0036071 RRM RNA recognition motif. 99.4
KOG0108|consensus 435 99.4
KOG0129|consensus520 99.37
smart0036071 RRM RNA recognition motif. 99.37
PLN03213 759 repressor of silencing 3; Provisional 99.36
KOG0130|consensus170 99.36
KOG0111|consensus298 99.36
KOG0130|consensus170 99.33
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.32
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.32
KOG0120|consensus 500 99.31
KOG1365|consensus 508 99.3
KOG1456|consensus 494 99.29
KOG0108|consensus 435 99.29
KOG0131|consensus 203 99.29
KOG0145|consensus360 99.28
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.27
KOG0111|consensus 298 99.27
KOG1190|consensus 492 99.23
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.22
KOG4208|consensus214 99.2
KOG0109|consensus346 99.17
smart0036170 RRM_1 RNA recognition motif. 99.16
KOG0415|consensus479 99.15
KOG1456|consensus494 99.14
KOG0415|consensus 479 99.11
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.1
KOG0146|consensus371 99.08
KOG0226|consensus290 99.05
KOG0105|consensus 241 99.04
KOG4210|consensus285 99.03
KOG4454|consensus 267 99.02
KOG4205|consensus311 99.02
KOG0153|consensus377 98.93
KOG0116|consensus419 98.92
KOG4208|consensus214 98.92
KOG4307|consensus 944 98.81
KOG0128|consensus881 98.8
KOG4307|consensus 944 98.78
KOG1365|consensus 508 98.78
KOG4206|consensus 221 98.77
KOG0132|consensus 894 98.76
KOG0533|consensus243 98.75
KOG4209|consensus231 98.67
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.67
KOG4661|consensus 940 98.67
KOG0533|consensus243 98.66
KOG2193|consensus 584 98.65
KOG0226|consensus290 98.64
KOG0132|consensus 894 98.55
KOG4660|consensus 549 98.55
KOG4209|consensus231 98.5
KOG0112|consensus 975 98.48
KOG0153|consensus377 98.47
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.4
KOG0116|consensus419 98.31
KOG4661|consensus 940 98.3
KOG1457|consensus 284 98.29
KOG0151|consensus 877 98.25
KOG4454|consensus 267 98.21
KOG0151|consensus 877 98.17
KOG4660|consensus 549 98.09
KOG4676|consensus 479 98.05
KOG4210|consensus285 97.91
KOG1548|consensus 382 97.9
KOG1855|consensus 484 97.86
KOG0106|consensus 216 97.84
KOG2314|consensus 698 97.83
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.81
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.65
KOG0128|consensus 881 97.63
KOG1995|consensus351 97.62
KOG4849|consensus 498 97.61
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.59
KOG1996|consensus378 97.54
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.51
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.46
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.41
KOG1995|consensus 351 97.35
KOG0115|consensus 275 97.33
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 97.29
KOG3152|consensus 278 97.29
KOG4849|consensus 498 97.13
KOG0129|consensus520 97.07
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.01
KOG2202|consensus 260 96.86
KOG2416|consensus718 96.82
KOG2314|consensus 698 96.82
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.55
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.51
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.48
KOG2416|consensus 718 96.41
KOG3152|consensus278 96.28
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.2
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.1
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.96
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.85
KOG1855|consensus484 95.85
KOG2068|consensus 327 95.84
KOG4676|consensus 479 95.78
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.71
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 95.64
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.57
KOG0112|consensus 975 95.35
KOG2202|consensus260 95.08
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.83
KOG1996|consensus378 94.22
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 93.89
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.8
KOG0804|consensus 493 93.59
KOG2193|consensus 584 93.34
KOG4574|consensus 1007 93.15
KOG0115|consensus275 93.08
KOG2068|consensus327 92.98
KOG0804|consensus 493 92.81
KOG2253|consensus 668 90.56
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 89.66
KOG2135|consensus526 89.39
KOG4285|consensus350 88.55
KOG2591|consensus 684 85.92
KOG4483|consensus528 83.8
KOG2591|consensus 684 83.38
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 82.29
KOG2253|consensus 668 81.29
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 80.56
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 80.41
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=100.00  E-value=5.1e-35  Score=242.38  Aligned_cols=159  Identities=18%  Similarity=0.281  Sum_probs=144.4

Q ss_pred             CCCCCCceEEEcCCCCCCCHHHHHhcccCC-CeEEEEEeecCCCCCeecEEEEEeCCHHHHHHHHH-hCCCceeCCeEeE
Q psy1680           8 LPTEPPYTAFVGNLPNGITQGDVERFFPEQ-KLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALL-KDGRITVDGLQVR   85 (227)
Q Consensus         8 ~~~~~~~~l~V~nLp~~~t~~~l~~~f~~~-~i~~v~i~~~~~~~~~~g~afv~f~~~~~a~~al~-~~~~~~~~g~~l~   85 (227)
                      ......++|||+|||+++|+++|+++|+.| +|..|+|++|+.+++++|||||+|.+.++|.+||+ |++ ..+.+++|+
T Consensus       102 ~~~~~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG-~~l~gr~i~  180 (346)
T TIGR01659       102 DTNNSGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNG-ITVRNKRLK  180 (346)
T ss_pred             CCCCCCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCC-CccCCceee
Confidence            455678999999999999999999999999 99999999999999999999999999999999998 999 999999999


Q ss_pred             EEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcceeccCCC
Q psy1680          86 LDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGP  165 (227)
Q Consensus        86 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~  165 (227)
                      |.++.+....                                                         ....+|||+|||.
T Consensus       181 V~~a~p~~~~---------------------------------------------------------~~~~~lfV~nLp~  203 (346)
T TIGR01659       181 VSYARPGGES---------------------------------------------------------IKDTNLYVTNLPR  203 (346)
T ss_pred             eecccccccc---------------------------------------------------------cccceeEEeCCCC
Confidence            9987642210                                                         1234699999976


Q ss_pred             CCCCChhhHHhhhccccceEEEEEeecCCCCcccceEEEEEcCHHHHHHHHHHcCCccccC
Q psy1680         166 NRSNSMNDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDG  226 (227)
Q Consensus       166 ~~~~~~~~l~~~f~~~g~i~~v~i~~d~~t~~~~g~afV~F~~~~~a~~Al~~l~g~~i~g  226 (227)
                      .+  ++++|+++|++||.|+.|+|++|+.+++++|||||+|.+.++|++||+.||+..|+|
T Consensus       204 ~v--tee~L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~~~g  262 (346)
T TIGR01659       204 TI--TDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKREEAQEAISALNNVIPEG  262 (346)
T ss_pred             cc--cHHHHHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCHHHHHHHHHHhCCCccCC
Confidence            55  789999999999999999999999999999999999999999999999999998876



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG4483|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
2dng_A103 Solution Structure Of Rna Binding Domain In Eukaryo 9e-25
2dng_A103 Solution Structure Of Rna Binding Domain In Eukaryo 1e-08
1wi8_A104 Solution Structure Of The Rna Binding Domain Of Euk 2e-08
2j76_E100 Solution Structure And Rna Interactions Of The Rna 4e-08
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 1e-07
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 1e-04
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-04
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 3e-04
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 3e-04
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 5e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 5e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 8e-04
>pdb|2DNG|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 4h Length = 103 Back     alignment and structure

Iteration: 1

Score = 110 bits (274), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 52/97 (53%), Positives = 72/97 (74%), Gaps = 1/97 (1%) Query: 2 GRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEF 61 G + K LPTEPPYTA+VGNLP QGD++ F + + SVRLV+DK+TD+FKGFCYVEF Sbjct: 4 GSSGKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEF 63 Query: 62 VDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKG 98 +V++L++AL DG + D +R+DIA+G++ D G Sbjct: 64 DEVDSLKEALTYDGALLGD-RSLRVDIAEGRKQDKSG 99
>pdb|2DNG|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 4h Length = 103 Back     alignment and structure
>pdb|1WI8|A Chain A, Solution Structure Of The Rna Binding Domain Of Eukaryotic Initiation Factor 4b Length = 104 Back     alignment and structure
>pdb|2J76|E Chain E, Solution Structure And Rna Interactions Of The Rna Recognition Motif From Eukaryotic Translation Initiation Factor 4b Length = 100 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 100.0
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 100.0
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 100.0
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.98
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.97
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.97
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.97
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.89
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.86
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.86
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.85
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.84
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.84
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.83
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.83
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.83
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.82
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.82
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.82
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.82
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.82
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.82
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.82
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.82
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.81
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.81
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.81
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.81
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.81
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.81
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.81
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.81
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.81
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.81
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.8
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.8
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.8
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.8
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.8
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.8
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.8
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.8
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.8
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.8
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.8
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.8
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.8
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.8
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.8
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.79
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.79
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.79
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.79
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.79
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.79
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.79
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.79
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.79
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.79
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.79
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.79
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.79
2div_A99 TRNA selenocysteine associated protein; structural 99.79
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.78
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.78
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.78
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.78
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.78
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.78
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.78
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.78
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.78
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.78
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.78
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.78
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.78
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.78
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.78
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.78
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.78
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.78
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.78
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.78
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.78
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.77
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.77
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.77
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.77
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.77
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.77
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.77
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.77
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.77
2div_A99 TRNA selenocysteine associated protein; structural 99.77
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.77
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.77
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.77
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.77
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.77
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.77
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.77
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.77
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.77
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.77
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.77
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.77
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.77
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.77
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.76
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.76
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.76
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.76
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.76
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.76
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.76
2dis_A109 Unnamed protein product; structural genomics, RRM 99.76
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.76
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.76
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.76
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.76
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.76
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.76
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.76
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.76
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.76
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.76
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.76
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.76
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.76
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.76
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.75
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.75
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.75
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.75
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.75
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.75
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.75
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.75
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.75
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.75
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.75
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.75
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.75
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.75
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.75
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.75
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.75
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.75
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.74
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.74
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.74
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.74
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.74
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.74
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.74
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.74
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.74
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.74
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.74
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.74
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.74
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.74
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.74
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.74
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.74
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.74
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.74
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.74
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.74
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.74
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.74
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.59
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.73
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.73
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.73
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.73
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.73
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.73
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.73
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.73
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.73
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.73
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.73
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.73
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.73
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.73
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.73
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.73
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.73
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.73
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.73
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.72
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.72
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.72
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.72
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.72
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.72
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.72
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.72
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.72
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.72
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.72
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.72
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.72
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.72
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.72
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.72
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.71
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.71
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.71
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.71
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.71
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.71
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.71
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.71
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.71
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.7
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.7
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.7
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.7
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.7
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.7
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.7
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.7
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.7
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.7
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.7
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.7
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.69
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.69
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.69
2dis_A109 Unnamed protein product; structural genomics, RRM 99.69
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.69
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.69
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.69
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.69
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.69
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.69
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.69
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.69
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.69
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.69
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.69
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.69
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.69
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.69
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.68
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.68
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.68
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.68
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.68
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.68
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.68
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.68
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.68
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.67
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.67
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.67
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.67
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.67
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.67
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.67
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.67
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.66
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.47
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.66
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.66
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.65
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.65
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.65
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.65
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.65
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.65
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.65
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.65
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.65
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.65
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.64
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.64
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.64
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.64
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.64
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.64
1x5p_A97 Negative elongation factor E; structure genomics, 99.64
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.64
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.64
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.63
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.63
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.62
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.62
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.62
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.62
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.62
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.62
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.62
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.62
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.62
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.62
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.61
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.61
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.61
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.61
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.61
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.61
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.61
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.61
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.61
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.6
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.6
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.6
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.6
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.6
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.59
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.59
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.59
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.59
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.58
1x5p_A97 Negative elongation factor E; structure genomics, 99.58
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.58
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.57
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.57
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.57
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.57
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.56
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.56
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.56
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.55
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.54
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.54
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.53
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.5
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.5
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.49
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.47
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.47
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.46
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.46
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.46
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.46
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.43
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.42
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.41
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.4
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.38
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.26
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.26
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.26
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.19
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.11
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.09
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.07
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.01
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.0
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.99
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.72
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.71
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.57
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.88
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.8
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.55
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.42
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.37
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.35
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.17
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.0
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.95
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.93
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.9
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.9
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.65
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.0
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.71
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.47
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.2
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.88
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.66
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 81.78
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 80.99
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
Probab=100.00  E-value=8.4e-36  Score=229.30  Aligned_cols=168  Identities=18%  Similarity=0.287  Sum_probs=144.3

Q ss_pred             CCCCCCCCCceEEEcCCCCCCCHHHHHhcccCC-CeEEEEEeecCCCCCeecEEEEEeCCHHHHHHHHHhCCCceeCCeE
Q psy1680           5 QKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQ-KLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQ   83 (227)
Q Consensus         5 ~~~~~~~~~~~l~V~nLp~~~t~~~l~~~f~~~-~i~~v~i~~~~~~~~~~g~afv~f~~~~~a~~al~~~~~~~~~g~~   83 (227)
                      ..+....+.++|||+|||+++|+++|+++|++| .|..|.|++++.+++++|||||+|.+.++|.+||++++ ..+.|+.
T Consensus         5 ~~~~~~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~A~~~~~-~~~~g~~   83 (196)
T 1l3k_A            5 ESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP-HKVDGRV   83 (196)
T ss_dssp             ---CCCGGGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCS-CEETTEE
T ss_pred             cCCCCCCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcCCCCCccceEEEEeCCHHHHHHHHhcCC-CEECCEE
Confidence            445566778999999999999999999999999 99999999999999999999999999999999999988 9999999


Q ss_pred             eEEEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcceeccC
Q psy1680          84 VRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNN  163 (227)
Q Consensus        84 l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl  163 (227)
                      |.|.++.++......                                                   ....+..+|||+||
T Consensus        84 l~v~~~~~~~~~~~~---------------------------------------------------~~~~~~~~l~V~nL  112 (196)
T 1l3k_A           84 VEPKRAVSREDSQRP---------------------------------------------------GAHLTVKKIFVGGI  112 (196)
T ss_dssp             CEEEECCC--------------------------------------------------------------CCSEEEEECC
T ss_pred             eeeecccCccccccc---------------------------------------------------ccCCCcceEEEeCC
Confidence            999998765432110                                                   00124578999999


Q ss_pred             CCCCCCChhhHHhhhccccceEEEEEeecCCCCcccceEEEEEcCHHHHHHHHHHcCCccccCC
Q psy1680         164 GPNRSNSMNDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL  227 (227)
Q Consensus       164 ~~~~~~~~~~l~~~f~~~g~i~~v~i~~d~~t~~~~g~afV~F~~~~~a~~Al~~l~g~~i~gr  227 (227)
                      |..+  ++++|+++|++||.|..|.|++++.+|.++|||||+|.+.++|.+|++. +|..|+||
T Consensus       113 p~~~--t~~~l~~~F~~~G~i~~v~i~~~~~~g~~~g~afV~F~~~~~A~~A~~~-~~~~~~G~  173 (196)
T 1l3k_A          113 KEDT--EEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ-KYHTVNGH  173 (196)
T ss_dssp             TTTC--CHHHHHHHHTTTSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHC-SCCEETTE
T ss_pred             CCCC--CHHHHHHHHhcCCCeEEEEEeecCCCCCccceEEEEECCHHHHHHHHHh-CCcEECCE
Confidence            7655  7999999999999999999999999999999999999999999999987 68898885



>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 227
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 1e-12
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 9e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-10
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-09
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 9e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-07
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-07
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-07
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-07
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-07
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-07
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-07
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-07
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 6e-07
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 7e-07
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 7e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 8e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 9e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-06
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 3e-06
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-06
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 3e-06
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-06
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-06
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 8e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-06
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-05
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-05
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 5e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 6e-05
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 1e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-04
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-04
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 4e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 4e-04
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 8e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.001
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 0.002
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 0.002
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Eukaryotic translation initiation factor 4B
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 60.1 bits (145), Expect = 1e-12
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 2/99 (2%)

Query: 2   GRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPE-QKLVSVRLVKDKETDRFKGFCYVE 60
           G +   LP  PPYTAF+GNLP  +T+  ++ FF            +    +R KGF Y E
Sbjct: 4   GSSGSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAE 63

Query: 61  FVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGG 99
           F D+++L  AL  +   ++   ++R+D+AD  ++ + G 
Sbjct: 64  FEDLDSLLSALSLNEE-SLGNKRIRVDVADQAQDKDSGP 101


>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 100.0
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.86
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.86
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.86
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.85
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.85
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.85
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.84
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.84
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.84
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.83
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.83
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.83
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.83
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.83
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.82
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.82
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.82
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.82
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.82
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.82
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.82
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.82
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.82
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.82
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.82
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.82
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.82
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.82
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.82
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.81
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.81
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.81
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.81
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.81
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.81
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.81
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.81
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.81
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.8
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.8
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.8
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.8
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.79
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.79
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.79
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.79
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.79
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.79
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.79
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.79
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.79
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.78
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.78
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.78
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.78
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.78
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.78
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.77
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.77
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.77
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.77
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.77
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.77
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.77
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.76
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.76
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.75
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.75
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.75
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.75
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.75
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.75
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.74
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.74
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.74
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.74
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.74
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.74
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.74
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.73
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.73
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.73
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.73
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.73
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.73
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.73
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.72
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.72
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.72
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.72
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.72
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.72
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.72
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.71
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.71
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.71
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.71
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.71
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.71
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.7
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.7
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.7
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.7
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.7
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.7
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.69
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.69
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.69
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.68
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.68
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.68
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.67
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.67
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.66
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.66
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.66
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.65
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.65
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.65
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.65
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.64
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.63
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.63
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.63
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.61
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.61
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.61
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.6
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.59
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.58
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.58
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.58
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.57
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.56
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.54
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.53
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.53
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.46
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.45
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.45
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.41
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.4
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.4
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.39
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.39
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.24
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.26
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.07
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.95
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.94
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.93
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.75
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.29
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.02
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.3e-32  Score=206.54  Aligned_cols=160  Identities=19%  Similarity=0.294  Sum_probs=140.0

Q ss_pred             CceEEEcCCCCCCCHHHHHhcccCC-CeEEEEEeecCCCCCeecEEEEEeCCHHHHHHHHHhCCCceeCCeEeEEEecCC
Q psy1680          13 PYTAFVGNLPNGITQGDVERFFPEQ-KLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADG   91 (227)
Q Consensus        13 ~~~l~V~nLp~~~t~~~l~~~f~~~-~i~~v~i~~~~~~~~~~g~afv~f~~~~~a~~al~~~~~~~~~g~~l~v~~~~~   91 (227)
                      .++|||+|||+++|+++|+++|++| .|..+.+++++.++.++|||||+|.+.++|..|+.+++ ..+..+.+.+....+
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~-~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARP-HKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCS-CEETTEECEEEECCC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcC-Ccccccchhhhhhhh
Confidence            3799999999999999999999999 99999999999999999999999999999999999777 789999998888655


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcceeccCCCCCCCCh
Q psy1680          92 KRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGPNRSNSM  171 (227)
Q Consensus        92 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~~~~~~~  171 (227)
                      +......                                                   .......+|||+|||..+  ++
T Consensus        85 ~~~~~~~---------------------------------------------------~~~~~~~~i~V~~lp~~~--te  111 (183)
T d1u1qa_          85 REDSQRP---------------------------------------------------GAHLTVKKIFVGGIKEDT--EE  111 (183)
T ss_dssp             TTGGGST---------------------------------------------------TTTCCCSEEEEECCCTTC--CH
T ss_pred             ccccccc---------------------------------------------------ccccccceeEEccCCCcC--CH
Confidence            4432110                                                   001245689999997655  78


Q ss_pred             hhHHhhhccccceEEEEEeecCCCCcccceEEEEEcCHHHHHHHHHHcCCccccCC
Q psy1680         172 NDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL  227 (227)
Q Consensus       172 ~~l~~~f~~~g~i~~v~i~~d~~t~~~~g~afV~F~~~~~a~~Al~~l~g~~i~gr  227 (227)
                      ++|+++|+.||.|..+.|++|..++.++|||||+|.+.++|.+||+ +++..|+|+
T Consensus       112 ~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~~G~  166 (183)
T d1u1qa_         112 HHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTVNGH  166 (183)
T ss_dssp             HHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEETTE
T ss_pred             HHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeECCE
Confidence            9999999999999999999999999999999999999999999997 677888875



>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure