Diaphorina citri psyllid: psy16816

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470

MTKSECNTVNICSFLNVLLSRFQRHALGCFVLILVDILWALSSEIVKKVDQHVEDESYFTDQTEPPGELKFPLHNLFIQVFLLVSIKKLQSASRGLHGKVLFSGRSSGTESETENSMRKHVRFSKLTERPQVLGVPASFLMEAPVRHLSDKEANEALLARLSYQATLRTADFTFIQSTKYNIPQVAKVAFVFSFLRFGAEYTFTLLGAEAGTVALIYSSSSVLTLLICAFFPSSSSDKFSLSKCVTVCISVCGLILVTISDVYMEHLHIPSGSFLSLVSALFYSLYIVFLRRLEHEEKLDIVLFYGFVGLYNCLLLWPLFFLLHYNSWEVFSLPDRDQWVILLIEGLIGSVLTETLWLWGMLLTSPLIATLGLGLIVPLSMIANTSLYHVTYPRLFYVGAVPVVFAFVASILLAQMASRDPVLEILLSCVTSLSGPSLGRTSKKISDADSEQRESLININMCDQEVDHEA

cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccc

************SFLNVLLSRFQRHALGCFVLILVDILWALSSEIVKKVDQHVEDESYFTDQTEPPGELKFPLHNLFIQVFLLVSIKKLQSASRGLHGKVLF************************************************************************IQSTKYNIPQVAKVAFVFSFLRFGAEYTFTLLGAEAGTVALIYSSSSVLTLLICAFFPSSSSDKFSLSKCVTVCISVCGLILVTISDVYMEHLHIPSGSFLSLVSALFYSLYIVFLRRLEHEEKLDIVLFYGFVGLYNCLLLWPLFFLLHYNSWEVFSLPDRDQWVILLIEGLIGSVLTETLWLWGMLLTSPLIATLGLGLIVPLSMIANTSLYHVTYPRLFYVGAVPVVFAFVASILLAQMASRDPVLEILLSCVTSLSG***********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Solute carrier family 35 member F5	Putative solute transporter.	confident	Q8WV83
Solute carrier family 35 member F5	Putative solute transporter.	confident	Q8R314
Solute carrier family 35 member F5	Putative solute transporter.	confident	Q5R6J3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016020 [CC]	membrane	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 344-413
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 194-260
View the alignment between query and template
View the model in PyMOL