Diaphorina citri psyllid: psy16849

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-

MWQEFESFLLGPPAPCQVSPVSICNPTLGPTVMLSSSSQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNALMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQNKVITPPMSPMLTDPLLLNRTEVPPVNNNNNNNNTRVNINTPSKTKTRERRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIVPSSHSRTK

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccCEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccEEEEEEEcCEEECccccccccc

*WQEFESFLLGPPAPCQ******CNPTLGPTVMLSS*SQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYP***NNNLNVDESCVQISPLAYNALMTFVPNNENII************INGSFTKMIIADEVVCKEATENYQNKVI*********************************************************ACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAAT**********PFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIV********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0071310 [BP]	cellular response to organic substance	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0003690 [MF]	double-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0071495 [BP]	cellular response to endogenous stimulus	probable	GO:0009719, GO:0050896, GO:0008150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TF6, chain A
Confidence level:very confident
Coverage over the Query: 218-344
View the alignment between query and template
View the model in PyMOL