Psyllid ID: psy16849


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MWQEFESFLLGPPAPCQVSPVSICNPTLGPTVMLSSSSQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNALMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQNKVITPPMSPMLTDPLLLNRTEVPPVNNNNNNNNTRVNINTPSKTKTRERRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIVPSSHSRTK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHcccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEEEEcEEEEEccccccccc
cccccccccccccccccccccccccccccccccccccEEEEEcccccccEEEcccccccccccEEEcccccccccccccccccccccccccccEEcEEEcccccccccccccccccccccEEEcEEEEcccccccccccccccccccccccccHEccccEEccccccccccccccccccccEEEEEEcccccccccccccccEccccHHHEHcccccccccccccccccEccccHHHEHEccccccccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHHccccEEccccccccccccccccHHHHHHccccccccccccHccccEccccHHHHHHHHccccccccccccccccccc
mwqefesfllgppapcqvspvsicnptlgptvmlssssqivkeeygfptakyveepqlnqneefvDLDMLINYAAEQHSFsnmkkleddnfyvcsnvmfdsqnqlypsennnnlnvdescvqisplAYNALMtfvpnneniindmsppasptnringsftKMIIADEVVCKEATenyqnkvitppmspmltdplllnrtevppvnnnnnnnntrvnintpsktktrerrsgsrkkltshacfhpgcgktytksshLKAHLrthtgekpyqckwkgcgwkfarsDELTRHFrkhtgdrpfqckpnlvnpsikegkdlaatakcpsadtsqpfktWATVVSTYNFTRSTCHLILQAEIgvslkivpsshsrtk
MWQEFESFLLGPPAPCQVSPVSICNPTLGPTVMLSSSSQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNALMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENyqnkvitppmsPMLTDPLLLNRTEVPpvnnnnnnnntrvnintpsktktrerrsgsrkkltshacfhpgcgktytksSHLKAHLrthtgekpyqckwkgcgWKFARSDELTRHFrkhtgdrpfqckpnlvnpSIKEGKDLAATAKcpsadtsqpfkTWATVVSTYNFTRSTCHLILQaeigvslkivpsshsrtk
MWQEFESFLLGPPAPCQVSPVSICNPTLGPTVMLSSSSQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNALMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQNKVITPPMSPMLTDPLLLnrtevppvnnnnnnnntrvnintpSKTKTRERRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIVPSSHSRTK
*******FLLGPPAPCQVSPVSICNPTLGPTVMLSS*SQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYP***NNNLNVDESCVQISPLAYNALMTFVPNNENII************INGSFTKMIIADEVVCKEATENYQNKVI*********************************************************ACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKH************************************PFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIV********
*WQEFESFLLGPPAPCQ*******************************************************************************************************************************************************************************************************************************CFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAAT******************VS**NFTRSTCHLILQAEIGVS************
MWQEFESFLLGPPAPCQVSPVSICNPTLGPTVMLSSSSQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNALMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQNKVITPPMSPMLTDPLLLNRTEVPPVNNNNNNNNTRVNINTP*****************SHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIV********
***********************CNPTLGPTVMLSSSSQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNALMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQNKVITPPMSPMLTDPLLLNRTEVPPVNNNNNNNNTRVNINTPSKTKTRERRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIVPS******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWQEFESFLLGPPAPCQVSPVSICNPTLGPTVMLSSSSQIVKEEYGFPTAKYVEEPQLNQNEEFVDLDMLINYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNALMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQNKVITPPMSPMLTDPLLLNRTEVPPVNNNNNNNNTRVNINTPSKTKTRERRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPFKTWATVVSTYNFTRSTCHLILQAEIGVSLKIVPSSHSRTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query371 2.2.26 [Sep-21-2011]
Q13351362 Krueppel-like factor 1 OS yes N/A 0.229 0.234 0.704 1e-33
Q60793483 Krueppel-like factor 4 OS yes N/A 0.207 0.159 0.779 9e-33
O43474513 Krueppel-like factor 4 OS no N/A 0.207 0.150 0.779 1e-32
Q9Y5W3355 Krueppel-like factor 2 OS no N/A 0.204 0.214 0.789 8e-32
Q60843354 Krueppel-like factor 2 OS no N/A 0.204 0.214 0.776 6e-31
Q9ET58351 Krueppel-like factor 2 OS no N/A 0.204 0.216 0.776 9e-31
P46099358 Krueppel-like factor 1 OS no N/A 0.204 0.212 0.710 7e-29
Q13887457 Krueppel-like factor 5 OS no N/A 0.312 0.253 0.516 1e-28
Q60980344 Krueppel-like factor 3 OS no N/A 0.366 0.395 0.458 1e-27
P57682345 Krueppel-like factor 3 OS no N/A 0.326 0.350 0.5 1e-27
>sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 Back     alignment and function desciption
 Score =  144 bits (363), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (81%), Gaps = 3/88 (3%)

Query: 215 VNINTPSKTKTRERRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWK 274
           +    PSK   R RRS +RK+  +H C HPGCGK+YTKSSHLKAHLRTHTGEKPY C W+
Sbjct: 258 IAETAPSK---RGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWE 314

Query: 275 GCGWKFARSDELTRHFRKHTGDRPFQCK 302
           GCGW+FARSDELTRH+RKHTG RPF+C+
Sbjct: 315 GCGWRFARSDELTRHYRKHTGQRPFRCQ 342




Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.
Homo sapiens (taxid: 9606)
>sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 Back     alignment and function description
>sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 Back     alignment and function description
>sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 Back     alignment and function description
>sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=3 SV=1 Back     alignment and function description
>sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 Back     alignment and function description
>sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 Back     alignment and function description
>sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 Back     alignment and function description
>sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query371
242009533404 conserved hypothetical protein [Pediculu 0.415 0.381 0.525 7e-38
405974536416 Krueppel-like factor 1 [Crassostrea giga 0.288 0.257 0.634 1e-37
241997400324 zinc finger, putative [Ixodes scapularis 0.326 0.373 0.578 2e-35
269784847356 KLF2-like transcription factor [Saccoglo 0.404 0.421 0.525 2e-35
390346400402 PREDICTED: uncharacterized protein LOC57 0.253 0.233 0.708 2e-34
391331029405 PREDICTED: uncharacterized protein LOC10 0.776 0.711 0.329 3e-33
161511587389 KLF2/4 [Paracentrotus lividus] 0.245 0.233 0.670 6e-33
147906739413 Kruppel-like factor 17 [Xenopus laevis] 0.280 0.251 0.556 8e-33
328696831414 PREDICTED: Krueppel-like factor 6-like [ 0.309 0.277 0.581 1e-32
62825100 510 kruppel-like factor 4 [Sus scrofa] gi|19 0.493 0.358 0.421 2e-32
>gi|242009533|ref|XP_002425538.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509413|gb|EEB12800.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 92/175 (52%), Positives = 109/175 (62%), Gaps = 21/175 (12%)

Query: 132 MTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQN----KVITPPMS 187
           MT V    N    +SPPASP   I G+    +       ++     +N    K++TPP S
Sbjct: 225 MTPVSGYVNGSGTLSPPASP--EIQGTTPHDLFTAPHFNQQKILPSENLPSLKIMTPPSS 282

Query: 188 PMLTDPLLLNRTEVPPVNNNNNNNNTRVNINTPSKTKTRERRSGSRKKLTSHACFHPGCG 247
           P LT+ L    + +P VNN    + T+           R RRS  RKKLT+H C +PGC 
Sbjct: 283 PNLTEYL----SSLPVVNNQVIEHKTK-----------RGRRSCGRKKLTTHTCSNPGCR 327

Query: 248 KTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCK 302
           KTYTKSSHLKAHLRTHTGEKPYQC WKGC WKFARSDELTRH+RKHTGDRPFQC+
Sbjct: 328 KTYTKSSHLKAHLRTHTGEKPYQCGWKGCSWKFARSDELTRHYRKHTGDRPFQCR 382




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|405974536|gb|EKC39171.1| Krueppel-like factor 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|241997400|ref|XP_002433349.1| zinc finger, putative [Ixodes scapularis] gi|215490772|gb|EEC00413.1| zinc finger, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|269784847|ref|NP_001161575.1| KLF2-like transcription factor [Saccoglossus kowalevskii] gi|268054143|gb|ACY92558.1| KLF2-like transcription factor [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|390346400|ref|XP_781601.2| PREDICTED: uncharacterized protein LOC576170 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|391331029|ref|XP_003739953.1| PREDICTED: uncharacterized protein LOC100901904 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|161511587|gb|ABX71820.1| KLF2/4 [Paracentrotus lividus] Back     alignment and taxonomy information
>gi|147906739|ref|NP_001082133.1| Kruppel-like factor 17 [Xenopus laevis] gi|15919361|gb|AAL10792.1|AF353715_1 Kruppel-like transcription factor neptune [Xenopus laevis] gi|133777091|gb|AAH71074.2| LOC398243 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|328696831|ref|XP_003240145.1| PREDICTED: Krueppel-like factor 6-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|62825100|gb|AAY16111.1| kruppel-like factor 4 [Sus scrofa] gi|194719420|gb|ACF93740.1| Kruppel-like factor 4 isoform b [Sus scrofa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query371
UNIPROTKB|Q52JJ4510 KLF4 "Uncharacterized protein" 0.207 0.150 0.779 4.4e-36
UNIPROTKB|K7GNW9519 KLF2 "Uncharacterized protein" 0.207 0.148 0.779 6.1e-36
UNIPROTKB|Q0P5B6372 KLF1 "Kruppel-like factor 1 (E 0.207 0.206 0.766 2.4e-35
UNIPROTKB|E1C3K5409 KLF1 "Uncharacterized protein" 0.204 0.185 0.789 2.4e-35
UNIPROTKB|O43474513 KLF4 "Krueppel-like factor 4" 0.207 0.150 0.779 3.9e-35
MGI|MGI:1342287483 Klf4 "Kruppel-like factor 4 (g 0.207 0.159 0.779 1e-34
RGD|621445482 Klf4 "Kruppel-like factor 4 (g 0.207 0.159 0.779 1e-34
ZFIN|ZDB-GENE-011109-1380 klf2a "Kruppel-like factor 2a" 0.215 0.210 0.753 2.7e-34
ZFIN|ZDB-GENE-010129-1409 klf4b "Kruppel-like factor 4b" 0.215 0.195 0.777 1.2e-33
UNIPROTKB|F1PSS3369 KLF1 "Uncharacterized protein" 0.207 0.208 0.766 4.1e-33
UNIPROTKB|Q52JJ4 KLF4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 4.4e-36, Sum P(2) = 4.4e-36
 Identities = 60/77 (77%), Positives = 65/77 (84%)

Query:   226 RERRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDE 285
             R RRS  RK+  +H C + GCGKTYTKSSHLKAHLRTHTGEKPY C W GCGWKFARSDE
Sbjct:   414 RGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDE 473

Query:   286 LTRHFRKHTGDRPFQCK 302
             LTRH+RKHTG RPFQC+
Sbjct:   474 LTRHYRKHTGHRPFQCQ 490


GO:2000342 "negative regulation of chemokine (C-X-C motif) ligand 2 production" evidence=IEA
GO:0090051 "negative regulation of cell migration involved in sprouting angiogenesis" evidence=IEA
GO:0071363 "cellular response to growth factor stimulus" evidence=IEA
GO:0060761 "negative regulation of response to cytokine stimulus" evidence=IEA
GO:0048730 "epidermis morphogenesis" evidence=IEA
GO:0046985 "positive regulation of hemoglobin biosynthetic process" evidence=IEA
GO:0045444 "fat cell differentiation" evidence=IEA
GO:0045415 "negative regulation of interleukin-8 biosynthetic process" evidence=IEA
GO:0043154 "negative regulation of cysteine-type endopeptidase activity involved in apoptotic process" evidence=IEA
GO:0035166 "post-embryonic hemopoiesis" evidence=IEA
GO:0034115 "negative regulation of heterotypic cell-cell adhesion" evidence=IEA
GO:0032526 "response to retinoic acid" evidence=IEA
GO:0032088 "negative regulation of NF-kappaB transcription factor activity" evidence=IEA
GO:0031077 "post-embryonic camera-type eye development" evidence=IEA
GO:0019827 "stem cell maintenance" evidence=IEA
GO:0009913 "epidermal cell differentiation" evidence=IEA
GO:0008285 "negative regulation of cell proliferation" evidence=IEA
GO:0001190 "RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription" evidence=IEA
GO:0001085 "RNA polymerase II transcription factor binding" evidence=IEA
GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IEA
GO:0001010 "sequence-specific DNA binding transcription factor recruiting transcription factor activity" evidence=IEA
GO:0000987 "core promoter proximal region sequence-specific DNA binding" evidence=IEA
GO:0000790 "nuclear chromatin" evidence=IEA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|K7GNW9 KLF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P5B6 KLF1 "Kruppel-like factor 1 (Erythroid)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3K5 KLF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O43474 KLF4 "Krueppel-like factor 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1342287 Klf4 "Kruppel-like factor 4 (gut)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621445 Klf4 "Kruppel-like factor 4 (gut)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-011109-1 klf2a "Kruppel-like factor 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010129-1 klf4b "Kruppel-like factor 4b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PSS3 KLF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 4e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 42.0 bits (98), Expect = 4e-04
 Identities = 42/250 (16%), Positives = 85/250 (34%), Gaps = 5/250 (2%)

Query: 71  INYAAEQHSFSNMKKLEDDNFYVCSNVMFDSQNQLYPSENNNNLNVDESCVQISPLAYNA 130
            N     HS     +       +  + + ++      S + N    +     +   + + 
Sbjct: 119 DNNLLSSHSLPPSSRDPQLPDLLSISNLRNNPLPGNNSSSVNTPQSNSLHPPLPANSLSK 178

Query: 131 LMTFVPNNENIINDMSPPASPTNRINGSFTKMIIADEVVCKEATENYQNKVITPPMSPML 190
             +   +     N  +   S +     S +  I +          +    + T       
Sbjct: 179 DPSSNLSLLISSNVSTSIPSSSENSPLSSSYSIPSSSSDQNLENSSSSLPLTTNSQLSPK 238

Query: 191 TDPLLLNRTEVPPVNNNNNNNNTRVNINTPSKTKTRERRSGSRK-KLTSHACFHPGCGKT 249
           +       +     ++++ + + R ++ T S   +    S S   K  S       C  +
Sbjct: 239 SLLSQSPSSLSSSDSSSSASESPRSSLPTASSQSSSPNESDSSSEKGFSLPIKSKQCNIS 298

Query: 250 YTKSSHLKAHLRT--HTGE--KPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNL 305
           +++SS L  HLR+  H+GE  KP+ C +  CG  F+R+D L RH   HT   P + K   
Sbjct: 299 FSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLN 358

Query: 306 VNPSIKEGKD 315
            +       +
Sbjct: 359 SSSKFSPLLN 368


Length = 467

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 371
KOG2462|consensus279 99.82
KOG2462|consensus279 99.78
KOG3576|consensus267 99.41
KOG3576|consensus267 99.4
KOG1074|consensus 958 99.39
KOG3623|consensus1007 99.32
KOG3608|consensus467 99.29
KOG3608|consensus 467 99.05
KOG3623|consensus 1007 99.01
KOG1074|consensus 958 98.78
PHA00733128 hypothetical protein 98.57
PHA0276855 hypothetical protein; Provisional 98.44
PLN03086567 PRLI-interacting factor K; Provisional 98.34
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.32
PLN03086567 PRLI-interacting factor K; Provisional 98.19
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.0
PHA0276855 hypothetical protein; Provisional 97.87
PHA00733128 hypothetical protein 97.82
COG5189423 SFP1 Putative transcriptional repressor regulating 97.68
PHA0061644 hypothetical protein 97.67
PHA0073279 hypothetical protein 97.61
KOG3993|consensus500 97.35
KOG3993|consensus500 97.08
PHA0061644 hypothetical protein 96.83
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.71
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.49
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.43
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.39
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.26
COG5189423 SFP1 Putative transcriptional repressor regulating 96.03
PHA0073279 hypothetical protein 95.97
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.34
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 95.11
smart0035526 ZnF_C2H2 zinc finger. 94.78
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 94.66
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.62
PRK04860160 hypothetical protein; Provisional 94.45
COG5048467 FOG: Zn-finger [General function prediction only] 93.72
smart0035526 ZnF_C2H2 zinc finger. 93.56
KOG2231|consensus 669 93.42
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 93.41
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 93.32
COG5048467 FOG: Zn-finger [General function prediction only] 92.83
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.28
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 91.33
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 91.25
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 90.78
KOG2231|consensus 669 90.61
KOG4173|consensus253 89.61
PRK04860160 hypothetical protein; Provisional 87.84
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 87.57
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 85.48
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 83.07
KOG1146|consensus 1406 80.85
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 80.25
>KOG2462|consensus Back     alignment and domain information
Probab=99.82  E-value=4.8e-20  Score=173.79  Aligned_cols=122  Identities=26%  Similarity=0.443  Sum_probs=108.0

Q ss_pred             cCCCCCCCcCCCCCCCchhhcccccc-----------cCCCCCcccCchhHHHHHhhhcCCCccccccCCCCCcccChhH
Q psy16849        217 INTPSKTKTRERRSGSRKKLTSHACF-----------HPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDE  285 (371)
Q Consensus       217 ~~~p~~c~~c~~~~~~~~~l~~H~c~-----------h~~Cgk~F~~~s~L~~H~r~HtgeKpf~C~~~~CgK~F~~ks~  285 (371)
                      ....++|..|++...+...|.+|+..           |+.|||.|..-..|+.|+|+|+  -+++|.+  |||.|.+.+-
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~i--CGKaFSRPWL  202 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGI--CGKAFSRPWL  202 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCccccc--ccccccchHH
Confidence            45568999999999999988888643           4559999999999999999998  7899977  9999999999


Q ss_pred             HHHHhhhhcCCCCccCCCCCCCCCCCCcHHHHhhccCCCCCCCCCCCcccccccccccc
Q psy16849        286 LTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPFKTWATVVSTYNFT  344 (371)
Q Consensus       286 L~~H~r~HtgeKPykC~~~~C~ksF~~~~~L~~H~k~h~~~c~~~fk~~~~l~~h~~~~  344 (371)
                      |+.|+|+|+|||||.|..  |+|+|..+++|+.||++|.+.+.+.|.+|++-|.=..++
T Consensus       203 LQGHiRTHTGEKPF~C~h--C~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyL  259 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPH--CGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYL  259 (279)
T ss_pred             hhcccccccCCCCccCCc--ccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHH
Confidence            999999999999999999  999999999999999999998888888887776544333



>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-31
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-31
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-27
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 5e-21
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-17
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-12
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-12
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-12
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-12
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 6e-12
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 8e-12
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 8e-12
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 8e-12
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-11
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-11
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-09
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-09
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 6e-09
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-08
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-08
2ent_A48 Solution Structure Of The Second C2h2-Type Zinc Fin 2e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 3e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 8e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-06
1va1_A37 Solution Structure Of Transcription Factor Sp1 Dna 6e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 6e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 6e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-05
1sp2_A31 Nmr Structure Of A Zinc Finger Domain From Transcri 4e-05
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 1e-04
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 1e-04
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-04
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure

Iteration: 1

Score = 132 bits (333), Expect = 2e-31, Method: Composition-based stats. Identities = 55/69 (79%), Positives = 60/69 (86%) Query: 234 KKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELTRHFRKH 293 K+ +H C + GCGKTYTKSSHLKAHLRTHTGEKPY C W GCGWKFARSDELTRH+RKH Sbjct: 1 KRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH 60 Query: 294 TGDRPFQCK 302 TG RPFQC+ Sbjct: 61 TGHRPFQCQ 69
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2ENT|A Chain A, Solution Structure Of The Second C2h2-Type Zinc Finger Domain From Human Krueppel-Like Factor 15 Length = 48 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1VA1|A Chain A, Solution Structure Of Transcription Factor Sp1 Dna Binding Domain (Zinc Finger 1) Length = 37 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1SP2|A Chain A, Nmr Structure Of A Zinc Finger Domain From Transcription Factor Sp1f2, Minimized Average Structure Length = 31 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-46
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-45
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-21
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-40
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-40
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-16
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-29
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-29
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-24
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-27
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-27
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-15
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-27
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-23
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-25
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-20
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-25
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-20
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-20
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-19
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-17
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-17
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-13
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 4e-17
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-16
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-14
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-14
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-13
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-13
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-13
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-12
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-12
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 8e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-10
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-08
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 3e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 8e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-06
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 4e-06
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 3e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 8e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 1e-05
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
 Score =  152 bits (385), Expect = 4e-46
 Identities = 51/75 (68%), Positives = 58/75 (77%)

Query: 228 RRSGSRKKLTSHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKFARSDELT 287
                 +K   H C +PGC K YTKSSHLKAHLRTHTGEKPY+C W+GC W+FARSDELT
Sbjct: 5   SSGPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELT 64

Query: 288 RHFRKHTGDRPFQCK 302
           RH+RKHTG +PFQC 
Sbjct: 65  RHYRKHTGAKPFQCG 79


>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 32 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query371
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.79
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.76
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.75
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.74
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.73
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.73
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.72
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.71
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.68
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.68
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.67
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.67
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.67
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.67
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.65
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.65
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.64
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.61
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.6
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.58
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.55
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.54
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.54
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.51
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.46
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.45
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.42
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.42
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.4
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.39
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.39
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.38
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.38
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.36
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.36
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.36
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.35
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.35
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.35
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.34
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.29
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.29
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.27
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.26
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.26
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.25
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.25
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.2
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.2
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.17
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.15
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.05
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.03
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.03
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.03
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.01
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.99
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.98
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.98
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.98
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.97
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.97
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.95
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.93
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.92
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.89
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.88
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.86
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.86
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.85
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.83
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.79
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.78
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.76
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.75
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.74
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.73
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.73
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.72
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.72
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.71
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.71
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.71
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.71
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.71
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.7
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.69
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.69
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.68
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.68
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.68
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.68
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.67
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.67
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.67
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.67
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.67
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.66
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.66
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.65
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.65
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.65
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.65
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.64
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.63
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.62
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.61
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.6
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.6
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.59
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.59
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.58
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.58
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.58
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.58
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.57
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.56
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.56
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.55
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.55
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.52
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.51
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.49
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.45
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.45
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.45
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.44
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.44
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.42
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.4
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.37
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.37
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.35
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.33
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.31
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.3
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.25
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.23
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.23
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.22
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.21
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.16
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.1
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.09
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.07
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.99
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.96
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.95
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.95
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.89
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.88
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.87
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.86
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.85
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.83
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.83
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.82
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.81
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.81
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.77
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.77
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.76
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.75
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.75
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.74
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.74
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.73
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.73
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.73
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.89
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.7
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.7
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.67
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.84
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.66
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.64
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.8
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.61
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.76
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.59
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.72
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.56
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.56
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.51
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.5
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.49
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.48
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.47
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.41
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.21
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.23
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.41
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 92.83
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 92.73
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 91.36
2e72_A49 POGO transposable element with ZNF domain; zinc fi 89.01
2e72_A49 POGO transposable element with ZNF domain; zinc fi 85.71
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=3.3e-19  Score=153.26  Aligned_cols=114  Identities=32%  Similarity=0.610  Sum_probs=103.1

Q ss_pred             CCCCCCCcCCCCCCCchhhcccccc-----------------cCCCCCcccCchhHHHHHhhhcCCCccccccCCCCCcc
Q psy16849        218 NTPSKTKTRERRSGSRKKLTSHACF-----------------HPGCGKTYTKSSHLKAHLRTHTGEKPYQCKWKGCGWKF  280 (371)
Q Consensus       218 ~~p~~c~~c~~~~~~~~~l~~H~c~-----------------h~~Cgk~F~~~s~L~~H~r~HtgeKpf~C~~~~CgK~F  280 (371)
                      ...+.|..|++.|.....|..|+..                 |..|++.|.....|..|+++|+++++|.|.+++|++.|
T Consensus        23 ~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f  102 (155)
T 2rpc_A           23 QLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIF  102 (155)
T ss_dssp             CCSSSCCCCCCCBSSHHHHHHHHHTTTSCCTTCSSCCCCBTTCTTSSCCCSSHHHHHHHTHHHHCCCSEECSCTTTCCEE
T ss_pred             hcccccccCCcccCCHHHHHHHHHhhcCCCcccCCccccccCCCCcccccCCHHHHHHHHHhcCCCCcccCCcCCCCCcc
Confidence            4579999999999999999888643                 45589999999999999999999999999655699999


Q ss_pred             cChhHHHHHhhhhcCCCCccCCCCCCCCCCCCcHHHHhhccCCCCCCCCCC
Q psy16849        281 ARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCPSADTSQPF  331 (371)
Q Consensus       281 ~~ks~L~~H~r~HtgeKPykC~~~~C~ksF~~~~~L~~H~k~h~~~c~~~f  331 (371)
                      .....|.+|+++|+++++|+|.+.+|+++|.+...|.+|++.|+++..+.+
T Consensus       103 ~~~~~L~~H~~~h~~~~~~~C~~~~C~k~f~~~~~L~~H~~~H~~~k~~~c  153 (155)
T 2rpc_A          103 ARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKSGPS  153 (155)
T ss_dssp             SCHHHHHHHHTTTCSSCSBCCSSTTCCCCBSSHHHHHHSSTTTTSCCCSCS
T ss_pred             CCHHHHHHHHHhhCCCCCccCCCCCCCCccCCHHHHHHHHHHhcCCCCCCC
Confidence            999999999999999999999976699999999999999999998876554



>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 371
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-15
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-13
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-13
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-11
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-11
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-11
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-07
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 1e-10
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 5e-10
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-10
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-10
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-10
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-09
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-10
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 8e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-09
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 5e-09
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-06
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 5e-06
d1bhia_38 g.37.1.1 (A:) Transactivation domain of cre-bp1/at 1e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-04
d1tf3a131 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIII 4e-04
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 0.001
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 0.002
d2glia529 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo 0.002
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 0.003
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 692, ZNF692
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 65.9 bits (161), Expect = 5e-15
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 238 SHACFHPGCGKTYTKSSHLKAHLRTHTGEKPYQCKW 273
           S +C  P CGK++    HLK H++ H+  + Y C++
Sbjct: 1   SFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEF 36


>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Length = 31 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query371
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.48
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.1
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.01
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.99
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.95
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.94
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.94
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.89
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.87
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.85
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.82
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.82
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.8
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.79
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.78
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.77
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.76
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.74
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.73
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.67
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.67
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.66
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.64
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.63
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.59
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.58
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.56
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.55
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.52
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.48
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.45
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.13
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.1
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.04
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.98
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.81
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.7
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.64
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.61
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.6
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.49
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.38
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.29
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.27
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.24
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.21
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.21
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.01
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.95
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.93
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.91
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.88
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.8
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.68
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.61
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.53
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.32
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.3
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.19
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.05
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.01
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.97
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.96
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.85
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.65
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 95.39
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.11
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.08
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.89
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.74
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.56
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.52
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 94.42
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.36
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.3
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.95
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.71
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.69
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.45
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 92.37
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.33
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.27
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.24
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 91.61
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.27
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.25
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 90.04
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 89.53
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.03
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 87.04
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 85.34
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 85.07
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 84.64
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 84.39
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 83.79
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.48  E-value=7.3e-15  Score=104.61  Aligned_cols=53  Identities=30%  Similarity=0.609  Sum_probs=51.1

Q ss_pred             CCccccccCCCCCcccChhHHHHHhhhhcCCCCccCCCCCCCCCCCCcHHHHhhccCC
Q psy16849        266 EKPYQCKWKGCGWKFARSDELTRHFRKHTGDRPFQCKPNLVNPSIKEGKDLAATAKCP  323 (371)
Q Consensus       266 eKpf~C~~~~CgK~F~~ks~L~~H~r~HtgeKPykC~~~~C~ksF~~~~~L~~H~k~h  323 (371)
                      ||||.|  . ||+.|..+..|..|+++|+|++||+|.+  ||++|.....|.+|+++|
T Consensus         1 EK~y~C--~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC--Q-CGKSFTHKSQRDRHMSMHLGLRPYGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC--T-TSCEESSHHHHHHHHHHHSCCCSEECTT--TSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC--C-CCCeECCHHHhHHHhhccccccCCcCCC--cCCEecCHHHHHHHHhcC
Confidence            689999  4 9999999999999999999999999999  999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure