Diaphorina citri psyllid: psy16868

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MYIKQVIIHGFKSYKEQTVVEPFDKRHNVVVGRNGSGKSNFFFAIQFVLSDESTSLRHSDSRQALLHEGTGPRVVNAYVEIVFDNTDHRVPGFIRCRSTSVDLYRCSYG
cEEEEEEEEECccccccCEEcccccccEEEEcccccccHHHHHHHHHHHcccccccccccccccEEEccccccCEEEEEEEEEEcccccccccccEEEEEEEEEEECcc
MYIKQVIIHGFKSYKEQTVVEPFDKRHNVVVGRNGSGKSNFFFAIQFVLS**************LLHEGTGPRVVNAYVEIVFDNTDHRVPGFIRCRSTSVDLYRC***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYIKQVIIHGFKSYKEQTVVEPFDKRHNVVVGRNGSGKSNFFFAIQFVLSDESTSLRHSDSRQALLHEGTGPRVVNAYVEIVFDNTDHRVPGFIRCRSTSVDLYRCSYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structural maintenance of chromosomes protein 3 Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement.confidentQ9CW03
Structural maintenance of chromosomes protein 3 Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement.confidentQ9UQE7
Structural maintenance of chromosomes protein 3 Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement.confidentQ5R4K5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005575 [CC]cellular_componentconfident
GO:0034991 [CC]nuclear meiotic cohesin complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0008278, GO:0044446, GO:0031981, GO:0005634, GO:0043226, GO:0044454, GO:0005694, GO:0030893, GO:0000793, GO:0000794, GO:0000798, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0007126 [BP]meiosisprobableGO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0016363 [CC]nuclear matrixprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0045502 [MF]dynein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000800 [CC]lateral elementprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000793, GO:0000794, GO:0000795, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0036033 [MF]mediator complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0032876 [BP]negative regulation of DNA endoreduplicationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0010948, GO:0090329, GO:0050789, GO:0051052, GO:0010605, GO:0019222, GO:0010564, GO:2000113, GO:0060255, GO:0065007, GO:0031326, GO:0048519, GO:0051053, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008156, GO:0008150, GO:0051171, GO:0051172, GO:0032875, GO:0051726, GO:2000104, GO:0006275, GO:0010556, GO:0010558, GO:0048523
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000236 [BP]mitotic prometaphaseprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0007049, GO:0022403
GO:0030261 [BP]chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0071840, GO:0006139, GO:0044260, GO:0006323, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0044699, GO:0051276, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0000087 [BP]M phase of mitotic cell cycleprobableGO:0044699, GO:0000279, GO:0000278, GO:0009987, GO:0008150, GO:0044763, GO:0022403, GO:0022402, GO:0007049
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000796 [CC]condensin complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0019827 [BP]stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000775 [CC]chromosome, centromeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0001737 [BP]establishment of imaginal disc-derived wing hair orientationprobableGO:0048563, GO:0030030, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0007164, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0002009, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0035317, GO:0048569, GO:0048513, GO:0071840, GO:0048729, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0060429, GO:0009888, GO:0035114, GO:0001738, GO:0008150, GO:0048731, GO:0022008, GO:0001736, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0044763, GO:0009987, GO:0048736, GO:0048737
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007091 [BP]metaphase/anaphase transition of mitotic cell cycleprobableGO:0006996, GO:0044699, GO:0000278, GO:0008150, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0044770, GO:0044772, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0044784, GO:0007049
GO:0007064 [BP]mitotic sister chromatid cohesionprobableGO:0006996, GO:0044699, GO:0000070, GO:0000819, GO:0051276, GO:0000280, GO:0000278, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0071840, GO:0007059, GO:0007067, GO:0007049, GO:0007062
GO:0034990 [CC]nuclear mitotic cohesin complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0008278, GO:0044446, GO:0031981, GO:0005634, GO:0043226, GO:0044454, GO:0005694, GO:0030892, GO:0000793, GO:0000794, GO:0000798, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1E69, chain A
Confidence level:very confident
Coverage over the Query: 1-50,61-95
View the alignment between query and template
View the model in PyMOL