Diaphorina citri psyllid: psy1687


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MFPLHLTLQVIKRFILHAKKTGFVVEHDFIMATYLSDRVIVFEGSPSISTLANAPQNLLNGMNKFLSLLGITFRRDPNNFRPRINKNNSVKDCEQKRAGQYFFYEEP
ccHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHccEEEEEEcccccEEEEcccccHHHHHHHHHHHccccEEccccccccccccccccccHHHHHcccccccccc
*FPLHLTLQVIKRFILHAKKTGFVVEHDFIMATYLSDRVIVFEGSPSISTLANAPQNLLNGMNKFLSLLGITFRRDPNNFRPRIN**********KRAGQYFFYE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPLHLTLQVIKRFILHAKKTGFVVEHDFIMATYLSDRVIVFEGSPSISTLANAPQNLLNGMNKFLSLLGITFRRDPNNFRPRINKNNSVKDCEQKRAGQYFFYEEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-binding cassette sub-family E member 1 Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. May act as a chaperone for post-translational events during HIV-1 capsid assembly.confidentP61221
ATP-binding cassette sub-family E member 1 Antagonizes the binding of 2-5A (5'-phosphorylated 2',5'-linked oligoadenylates) by RNase L through direct interaction with RNase L and therefore inhibits its endoribonuclease activity. May play a central role in the regulation of mRNA turnover. Antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway.confidentP61222
ABC transporter E family member 2 confidentQ8LPJ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005852 [CC]eukaryotic translation initiation factor 3 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043024 [MF]ribosomal small subunit bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0022626 [CC]cytosolic ribosomeprobableGO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0043524 [BP]negative regulation of neuron apoptotic processprobableGO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0009615 [BP]response to virusprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0006935 [BP]chemotaxisprobableGO:0040011, GO:0042330, GO:0009605, GO:0050896, GO:0008150, GO:0042221
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0051536 [MF]iron-sulfur cluster bindingprobableGO:0003674, GO:0051540, GO:0005488
GO:0008428 [MF]ribonuclease inhibitor activityprobableGO:0004857, GO:0003674, GO:0030234
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0006401 [BP]RNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699
GO:0006413 [BP]translational initiationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3J16, chain B
Confidence level:very confident
Coverage over the Query: 5-106
View the alignment between query and template
View the model in PyMOL