Diaphorina citri psyllid: psy16881


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MHEFPMGDGPSLFNGTELILRGSVHIGSNMRCVRFSPDTRLLATGGDDETVTVWRSDDLSLIMETNDRGHTQGRIEGWGRVPACPLCRTRVFSTFVKQIIPTRVGVYGQDSETVGRHTSAVTSVRFNHKSSLLVSGSVDKTVKLWDVPSLTCIKTLESHTRYVTCCTFSCDDSLLASGSNDKTVTIWDMLATLLASGSNDKTVTIWDMRGNLSVDVPLNYCC
cCEEEcccccEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccccccccccEEEEEECcccccEEEEEccccEEEEEEccccCEEcccccccccEEEEEEcccccEEEEccccccEEEEEccccCEEEEcccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEECccccEEEEEcccccEEcccccccc
MHEFPMGDGPSLFNGTELILRGSVHIGSNMRCVRFSPDTRLLATGGDDETVTVWRSDDLSLIMETNDRGHTQGRIEGWGRVPACPLCRTRVFSTFVKQIIPTRVGVYGQDSETVGRHTSAVTSVRFNHKSSLLVSGSVDKTVKLWDVPSLTCIKTLESHTRYVTCCTFSCDDSLLASGSNDKTVTIWDMLATLLASGSNDKTVTIWDMRGNLSVDVPLNYCC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHEFPMGDGPSLFNGTELILRGSVHIGSNMRCVRFSPDTRLLATGGDDETVTVWRSDDLSLIMETNDRGHTQGRIEGWGRVPACPLCRTRVFSTFVKQIIPTRVGVYGQDSETVGRHTSAVTSVRFNHKSSLLVSGSVDKTVKLWDVPSLTCIKTLESHTRYVTCCTFSCDDSLLASGSNDKTVTIWDMLATLLASGSNDKTVTIWDMRGNLSVDVPLNYCC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0045502 [MF]dynein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HES, chain X
Confidence level:very confident
Coverage over the Query: 19-210
View the alignment between query and template
View the model in PyMOL