Diaphorina citri psyllid: psy16906


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSVFSK
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccCEEcHHcHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHcccccc
MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSV*S*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSVFSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 4V2 Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12). May have a role in fatty acid and steroid metabolism in the eye.confidentQ6ZWL3
Cytochrome P450 4V2 Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12). May have a role in fatty acid and steroid metabolism in the eye.confidentQ5RCN6
Cytochrome P450 4V2 Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12).confidentQ9DBW0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0010430 [BP]fatty acid omega-oxidationprobableGO:0034440, GO:0006631, GO:0006629, GO:0006082, GO:0044238, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0019395, GO:0044255, GO:0030258, GO:0055114, GO:0044281

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MDM, chain A
Confidence level:very confident
Coverage over the Query: 2-82
View the alignment between query and template
View the model in PyMOL