Psyllid ID: psy16906

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120

MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSVFSK

cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcHHcHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHcccccc

cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHccccHHHHHHHHHHHHccccc

mitptfhfKILDVFVDVFVEKCQILVDKlgdkcdgkafdvyPFITRCAMDIICETAMGieinaqrdsksDYVRAVYEISELTIVRslrpwlwhplvfkwtkyastihlpcrvpsnsvfsk

mitptfhfkildVFVDVFVEKCQILVdklgdkcdgkAFDVYPFITRCAMDIICETAMGIEinaqrdsksDYVRAVYEISELtivrslrpwLWHPLVFKWTKYASTihlpcrvpsnsvfsk

MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSVFSK

****TFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRV********

MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINA***SKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSV*S*

MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSVFSK

MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSVFS*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSVFSK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		120	2.2.26 [Sep-21-2011]
P29981		511	Cytochrome P450 4C1 OS=Bl	N/A	N/A	0.833	0.195	0.71	3e-37
Q6ZWL3		525	Cytochrome P450 4V2 OS=Ho	yes	N/A	0.766	0.175	0.532	3e-23
Q5RCN6		525	Cytochrome P450 4V2 OS=Po	yes	N/A	0.766	0.175	0.521	5e-23
Q9DBW0		525	Cytochrome P450 4V2 OS=Mu	yes	N/A	0.816	0.186	0.514	1e-22
Q9VA27		535	Cytochrome P450 4c3 OS=Dr	yes	N/A	0.891	0.2	0.429	2e-22
A2RRT9		525	Cytochrome P450 4V2 OS=Ra	yes	N/A	0.791	0.180	0.494	1e-20
Q9VXY0		495	Probable cytochrome P450	no	N/A	0.841	0.204	0.465	1e-19
Q964T1		501	Cytochrome P450 4c21 OS=B	N/A	N/A	0.85	0.203	0.431	2e-19
Q27589		501	Cytochrome P450 4d2 OS=Dr	no	N/A	0.841	0.201	0.411	2e-18
Q9VS79		463	Cytochrome P450 4d8 OS=Dr	no	N/A	0.833	0.215	0.45	8e-17

>sp\|P29981\|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1	Back alignment and function desciption

 Score =  153 bits (387), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%)

Query: 1   MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIE 60
           MITPTFHFKILD+FVDVFVEK +ILV KL  K  GK FD+YPFIT CA+DIICETAMGI+
Sbjct: 133 MITPTFHFKILDIFVDVFVEKSEILVKKLQSKVGGKDFDIYPFITHCALDIICETAMGIQ 192

Query: 61  INAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWT 100
           +NAQ +S+S+YV+AVYEISELT+ RS+RPWL   ++F  T
Sbjct: 193 MNAQEESESEYVKAVYEISELTMQRSVRPWLHPKVIFDLT 232

Involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Blaberus discoidalis (taxid: 6981)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 4EC: .EC: 1

>sp\|Q6ZWL3\|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2	Back alignment and function description

>sp\|Q5RCN6\|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1	Back alignment and function description

>sp\|Q9DBW0\|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1	Back alignment and function description

>sp\|Q9VA27\|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1	Back alignment and function description

>sp\|A2RRT9\|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1	Back alignment and function description

>sp\|Q9VXY0\|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1	Back alignment and function description

>sp\|Q964T1\|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1	Back alignment and function description

>sp\|Q27589\|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2	Back alignment and function description

>sp\|Q9VS79\|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		120
339896241		509	cytochrome P450 [Bemisia tabaci]	0.858	0.202	0.689	4e-37
399631520		510	cytochrome P450 [Bemisia tabaci]	0.858	0.201	0.689	4e-37
231885		511	RecName: Full=Cytochrome P450 4C1; AltNa	0.833	0.195	0.71	1e-35
408724215		520	cytochrome P450 CYP4C62 [Laodelphax stri	0.866	0.2	0.663	2e-34
189178726		520	cytochrome P450 [Nilaparvata lugens]	0.866	0.2	0.644	5e-34
443419052		309	fat body cytochrome p450, partial [Locus	0.816	0.317	0.581	2e-27
189178724		502	cytochrome P450 [Nilaparvata lugens]	0.891	0.213	0.523	2e-27
408724293		385	cytochrome P450 CYP4C71v2, partial [Laod	0.891	0.277	0.514	3e-27
408724277		398	cytochrome P450 CYP4C71v2, partial [Laod	0.891	0.268	0.514	5e-27
392612327		515	cytochrome P450 [Exopalaemon carinicauda	0.891	0.207	0.514	3e-26

>gi\|339896241\|gb\|AEK21806.1\| cytochrome P450 [Bemisia tabaci]	Back alignment and taxonomy information

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 84/103 (81%)

Query: 1   MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIE 60
           MITPTFHFKILD+F +VFVEKCQ+LV+KL  K + + FD+YPFITRCA+DIICETAMG E
Sbjct: 133 MITPTFHFKILDIFQEVFVEKCQLLVEKLKSKANNEPFDIYPFITRCALDIICETAMGTE 192

Query: 61  INAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKWTKYA 103
           INAQ  + SDYVRA+Y+ISELT+ RS +PW W  LVF  T Y 
Sbjct: 193 INAQEKTDSDYVRAIYDISELTLKRSFQPWFWPDLVFNMTDYG 235

Source: Bemisia tabaci

Species: Bemisia tabaci

Genus: Bemisia

Family: Aleyrodidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|399631520\|gb\|AFP49818.1\| cytochrome P450 [Bemisia tabaci]	Back alignment and taxonomy information

>gi\|231885\|sp\|P29981.1\|CP4C1_BLADI RecName: Full=Cytochrome P450 4C1; AltName: Full=CYPIVC1 gi\|155947\|gb\|AAA27819.1\| cytochrome P450 [Blaberus discoidalis]	Back alignment and taxonomy information

>gi\|408724215\|gb\|AFU86425.1\| cytochrome P450 CYP4C62 [Laodelphax striatella]	Back alignment and taxonomy information

>gi\|189178726\|emb\|CAQ57675.1\| cytochrome P450 [Nilaparvata lugens]	Back alignment and taxonomy information

>gi\|443419052\|gb\|AGC84398.1\| fat body cytochrome p450, partial [Locusta migratoria]	Back alignment and taxonomy information

>gi\|189178724\|emb\|CAQ57674.1\| cytochrome P450 [Nilaparvata lugens]	Back alignment and taxonomy information

>gi\|408724293\|gb\|AFU86464.1\| cytochrome P450 CYP4C71v2, partial [Laodelphax striatella]	Back alignment and taxonomy information

>gi\|408724277\|gb\|AFU86456.1\| cytochrome P450 CYP4C71v2, partial [Laodelphax striatella]	Back alignment and taxonomy information

>gi\|392612327\|gb\|AFM82473.1\| cytochrome P450 [Exopalaemon carinicauda]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		120
UNIPROTKB\|E1BYW5		530	CYP4V2 "Uncharacterized protei	0.808	0.183	0.515	1.8e-21
UNIPROTKB\|F1N3Z7		527	CYP4V2 "Uncharacterized protei	0.808	0.184	0.515	3e-21
MGI\|MGI:2142763		525	Cyp4v3 "cytochrome P450, famil	0.816	0.186	0.514	4.8e-21
UNIPROTKB\|Q6ZWL3		525	CYP4V2 "Cytochrome P450 4V2" [	0.766	0.175	0.532	6.2e-21
UNIPROTKB\|F1PNR5		523	CYP4V2 "Uncharacterized protei	0.8	0.183	0.520	7.9e-21
UNIPROTKB\|Q5RCN6		525	CYP4V2 "Cytochrome P450 4V2" [	0.766	0.175	0.521	1e-20
ZFIN\|ZDB-GENE-061103-88		510	cyp4v7 "cytochrome P450, famil	0.841	0.198	0.465	1.2e-20
FB\|FBgn0015032		535	Cyp4c3 "Cytochrome P450-4c3" [	0.891	0.2	0.429	1.4e-20
WB\|WBGene00016147		529	cyp-32A1 [Caenorhabditis elega	0.766	0.173	0.478	1.3e-19
ZFIN\|ZDB-GENE-061103-601		513	cyp4v8 "cytochrome P450, famil	0.816	0.191	0.47	2.5e-19

UNIPROTKB\|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

 Score = 258 (95.9 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 50/97 (51%), Positives = 68/97 (70%)

Query:     1 MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIE 60
             MITPTFHF IL+ F++V  E+  IL++KL    D + F+++  IT CA+DIICETAMG  
Sbjct:   150 MITPTFHFAILNDFLEVMNEQGGILLEKLEKHVDKEPFNIFTDITLCALDIICETAMGKN 209

Query:    61 INAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVF 97
             + AQ +  S+YVRAVY +S+L   R   PWLWH L++
Sbjct:   210 LGAQDNKDSEYVRAVYRMSDLIQQRQKSPWLWHDLMY 246

GO:0005506 "iron ion binding" evidence=IEA

GO:0009055 "electron carrier activity" evidence=IEA

GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA

GO:0020037 "heme binding" evidence=IEA

GO:0004497 "monooxygenase activity" evidence=IEA

GO:0010430 "fatty acid omega-oxidation" evidence=IEA

UNIPROTKB\|F1N3Z7 CYP4V2 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:2142763 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6ZWL3 CYP4V2 "Cytochrome P450 4V2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PNR5 CYP4V2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5RCN6 CYP4V2 "Cytochrome P450 4V2" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061103-88 cyp4v7 "cytochrome P450, family 4, subfamily V, polypeptide 7" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

FB\|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

WB\|WBGene00016147 cyp-32A1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061103-601 cyp4v8 "cytochrome P450, family 4, subfamily V, polypeptide 8" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6ZWL3	CP4V2_HUMAN	1, ., 1, 4, ., 1, 3, ., -	0.5326	0.7666	0.1752	yes	N/A
Q5RCN6	CP4V2_PONAB	1, ., 1, 4, ., 1, 3, ., -	0.5217	0.7666	0.1752	yes	N/A
Q9DBW0	CP4V2_MOUSE	1, ., 1, 4, ., 1, 3, ., -	0.5148	0.8166	0.1866	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		120
pfam00067		461	pfam00067, p450, Cytochrome P450	9e-14

>gnl\|CDD\|215689 pfam00067, p450, Cytochrome P450	Back alignment and domain information

 Score = 65.8 bits (161), Expect = 9e-14
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 2/101 (1%)

Query: 1   MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCD-GKAFDVYPFITRCAMDIICETAMGI 59
            +TPTF       F     E+ + LV+KL          D+   + R A+++IC    G 
Sbjct: 101 FLTPTFTSFGKLSFEPRVEEEARDLVEKLRKTAGEPGVIDITDLLFRAALNVICSILFGE 160

Query: 60  EINAQRDSK-SDYVRAVYEISELTIVRSLRPWLWHPLVFKW 99
              +  D K  + V+AV E+S L    S +     P++  +
Sbjct: 161 RFGSLEDPKFLELVKAVQELSSLLSSPSPQLLDLFPILKYF 201

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		120
KOG0157\|consensus		497		99.29
PLN02169		500	fatty acid (omega-1)-hydroxylase/midchain alkane h	99.17
KOG0158\|consensus		499		99.17
PLN02738		633	carotene beta-ring hydroxylase	99.15
PLN03234		499	cytochrome P450 83B1; Provisional	99.13
PLN02936		489	epsilon-ring hydroxylase	99.1
PLN02426		502	cytochrome P450, family 94, subfamily C protein	99.09
PLN02966		502	cytochrome P450 83A1	98.98
PLN02687		517	flavonoid 3'-monooxygenase	98.94
KOG0159\|consensus		519		98.93
PLN03195		516	fatty acid omega-hydroxylase; Provisional	98.9
PLN02290		516	cytokinin trans-hydroxylase	98.87
PLN00110		504	flavonoid 3',5'-hydroxylase (F3'5'H); Provisional	98.73
PLN03112		514	cytochrome P450 family protein; Provisional	98.73
PTZ00404		482	cytochrome P450; Provisional	98.72
KOG0156\|consensus		489		98.71
PF00067		463	p450: Cytochrome P450 p450 superfamily signature b	98.61
PLN00168		519	Cytochrome P450; Provisional	98.59
PLN02183		516	ferulate 5-hydroxylase	98.53
PLN02971		543	tryptophan N-hydroxylase	98.41
PLN02394		503	trans-cinnamate 4-monooxygenase	98.36
PLN02655		466	ent-kaurene oxidase	98.22
PLN02648		480	allene oxide synthase	98.2
PLN02500		490	cytochrome P450 90B1	98.15
PLN03018		534	homomethionine N-hydroxylase	98.06
PLN02302		490	ent-kaurenoic acid oxidase	97.94
PLN02196		463	abscisic acid 8'-hydroxylase	97.86
COG2124		411	CypX Cytochrome P450 [Secondary metabolites biosyn	97.8
PLN02774		463	brassinosteroid-6-oxidase	97.5
PLN03141		452	3-epi-6-deoxocathasterone 23-monooxygenase; Provis	97.42
PLN02987		472	Cytochrome P450, family 90, subfamily A	94.53

>KOG0157\|consensus	Back alignment and domain information

Probab=99.29  E-value=1.8e-11  Score=83.85  Aligned_cols=115  Identities=30%  Similarity=0.500  Sum_probs=88.9

Q ss_pred             CCCCCCChHhHHHHHHHHHHHHHHHHHHHhhhcCCCceehhHHHHHHHHHHHHHHhhcccc-cccCCCccHHHHHHHHHH
Q psy16906          1 MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEI-NAQRDSKSDYVRAVYEIS   79 (120)
Q Consensus         1 ~l~p~fs~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~vd~~~~~~~~~~dvi~~~~fg~~~-~~~~~~~~~~~~~~~~~~   79 (120)
                      +++|+|+.+.++++.+.+.+++..+...+.....++.+|+.+.+.++|+|++|.++||... +.......++.+++..+.
T Consensus       135 ~~~~~f~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~vd~~~~~~~~tld~i~~~~~G~~~~~~~~~~~~~~~~a~~~~~  214 (497)
T KOG0157|consen  135 LLTPAFHFEILKSFVPVFIESSLILLLLLELAASGEEVDLQDLLKRLTLDIICKTAMGPESLDAEGPELFEYVQAFDDLT  214 (497)
T ss_pred             hccHhhhHHHHHHHHHHHHHHHHHHHHHHHHhhcCCeEcHHHHHHHHHHHHHHHHhcCCccccccCCcccHHHHHHHHHH
Confidence            4789999999999999999999998888877443444999999999999999999999332 222223468999999998


Q ss_pred             HHHHHhhcccccchHHHHhcChhhhhhcccccCCCccc
Q psy16906         80 ELTIVRSLRPWLWHPLVFKWTKYASTIHLPCRVPSNSV  117 (120)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~  117 (120)
                      ..+..+...|+ ...+++.+. .++++.++.+.+++.+
T Consensus       215 ~~~~~~~~~p~-~~~~~~~~~-~~~~~~~a~~~~~~~~  250 (497)
T KOG0157|consen  215 ELISKRINLPL-GTKFLYGLK-SERKLKKARKILHDFL  250 (497)
T ss_pred             HHHHHHHcCch-hhhHHhhcc-hHHHHHHHHHHHHHHH
Confidence            88888888886 444444443 6677777776666543

>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase	Back alignment and domain information

>KOG0158\|consensus	Back alignment and domain information

>PLN02738 carotene beta-ring hydroxylase	Back alignment and domain information

>PLN03234 cytochrome P450 83B1; Provisional	Back alignment and domain information

>PLN02936 epsilon-ring hydroxylase	Back alignment and domain information

>PLN02426 cytochrome P450, family 94, subfamily C protein	Back alignment and domain information

>PLN02966 cytochrome P450 83A1	Back alignment and domain information

>PLN02687 flavonoid 3'-monooxygenase	Back alignment and domain information

>KOG0159\|consensus	Back alignment and domain information

>PLN03195 fatty acid omega-hydroxylase; Provisional	Back alignment and domain information

>PLN02290 cytokinin trans-hydroxylase	Back alignment and domain information

>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional	Back alignment and domain information

>PLN03112 cytochrome P450 family protein; Provisional	Back alignment and domain information

>PTZ00404 cytochrome P450; Provisional	Back alignment and domain information

>KOG0156\|consensus	Back alignment and domain information

>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry

Back alignment and domain information

>PLN00168 Cytochrome P450; Provisional	Back alignment and domain information

>PLN02183 ferulate 5-hydroxylase	Back alignment and domain information

>PLN02971 tryptophan N-hydroxylase	Back alignment and domain information

>PLN02394 trans-cinnamate 4-monooxygenase	Back alignment and domain information

>PLN02655 ent-kaurene oxidase	Back alignment and domain information

>PLN02648 allene oxide synthase	Back alignment and domain information

>PLN02500 cytochrome P450 90B1	Back alignment and domain information

>PLN03018 homomethionine N-hydroxylase	Back alignment and domain information

>PLN02302 ent-kaurenoic acid oxidase	Back alignment and domain information

>PLN02196 abscisic acid 8'-hydroxylase	Back alignment and domain information

>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PLN02774 brassinosteroid-6-oxidase	Back alignment and domain information

>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional	Back alignment and domain information

>PLN02987 Cytochrome P450, family 90, subfamily A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		120
3mdm_A		456	Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th	9e-37
3s79_A		503	Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD	1e-30
2ij2_A		470	Cytochrome P450 BM3; monoxygenase, heme binding pr	2e-28
3dbg_A		467	Putative cytochrome P450; cytochrome P450 oxidored	4e-24
3gw9_A		450	Sterol 14alpha-demethylase; CYP51, cytochrome P450	1e-21
3i3k_A		461	Lanosterol 14-alpha demethylase; cytochrome P450,	3e-19
2cib_A		455	Cytochrome P450 51; heme, heme lipid synthesis, me	4e-17
1n97_A		389	CYP175A1; electron transport; HET: SRT HEM; 1.80A	4e-17
3n9y_A		487	Cholesterol SIDE-chain cleavage enzyme; cytochrome	5e-15
3k9v_A		482	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho	1e-14
3dsk_A		495	Cytochrome P450 74A, chloroplast; P450 fold, fatty	3e-13
3b6h_A		498	Prostacyclin synthase; enzyme-inhibitor complex, C	2e-11
2ve3_A		444	Putative cytochrome P450 120; oxidoreductase, mono	1e-10
3dan_A		473	Cytochrome P450 74A2; AOS heme cytochrome P450 str	2e-07
3nxu_A		485	Cytochrome P450 3A4; alpha beta protein, cytochrom	7e-07
1izo_A		417	P450bsbeta, cytochrome P450 152A1; heme protein, p	4e-05
3awm_A		415	Fatty acid alpha-hydroxylase; cytochrome P450, per	4e-05

>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456	Back alignment and structure

 Score =  128 bits (324), Expect = 9e-37
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 1   MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKA-FDVYPFITRCAMDIICETAMGI 59
           +I   F    L   ++ F EK + LV+ L  K DG+    +   +T  AMDI+ + A G+
Sbjct: 92  VIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGM 151

Query: 60  EINAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFK 98
           E +    ++    +AV  + E           + P   K
Sbjct: 152 ETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRK 190

PyMOL of 3mdm

>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503	Back alignment and structure

>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470	Back alignment and structure

>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467	Back alignment and structure

>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450	Back alignment and structure

>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455	Back alignment and structure

>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389	Back alignment and structure

>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487	Back alignment and structure

>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482	Back alignment and structure

>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495	Back alignment and structure

>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498	Back alignment and structure

>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444	Back alignment and structure

>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473	Back alignment and structure

>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485	Back alignment and structure

>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417	Back alignment and structure

>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		120
3mdm_A		456	Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th	99.05
2ij2_A		470	Cytochrome P450 BM3; monoxygenase, heme binding pr	99.0
3nxu_A		485	Cytochrome P450 3A4; alpha beta protein, cytochrom	99.0
3k9v_A		482	1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho	98.89
3n9y_A		487	Cholesterol SIDE-chain cleavage enzyme; cytochrome	98.83
3dbg_A		467	Putative cytochrome P450; cytochrome P450 oxidored	98.73
2fdv_A		476	Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m	98.63
1n97_A		389	CYP175A1; electron transport; HET: SRT HEM; 1.80A	98.62
2cib_A		455	Cytochrome P450 51; heme, heme lipid synthesis, me	98.52
3s79_A		503	Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD	98.48
3czh_A		481	Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro	98.47
1izo_A		417	P450bsbeta, cytochrome P450 152A1; heme protein, p	98.47
2ve3_A		444	Putative cytochrome P450 120; oxidoreductase, mono	98.46
3swz_A		494	Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro	98.44
3awm_A		415	Fatty acid alpha-hydroxylase; cytochrome P450, per	98.42
1jfb_A		404	Nitric-oxide reductase cytochrome P450 55A1; cytoc	98.39
3gw9_A		450	Sterol 14alpha-demethylase; CYP51, cytochrome P450	98.39
2wm5_A		435	CYP124, putative cytochrome P450 124; metal-bindin	98.34
1odo_A		408	Putative cytochrome P450 154A1; P450 monooxygenase	98.29
3e6i_A		476	CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono	98.29
3pm0_A		507	Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase	98.25
1po5_A		476	Cytochrome P450 2B4; oxidoreductase, membrane prot	98.24
1r9o_A		477	Cytochrome P450 2C9; monooxygenase, drug metaboliz	98.24
2dkk_A		411	Cytochrome P450; CYP158A1, INHI oxidoreductase; HE	98.22
2zbx_A		412	Cytochrome P450-SU1; beta prism, heme, iron, metal	98.22
3oo3_A		384	OXY protein; cytochrome P450, monooxygenase, PCD-t	98.19
3tyw_A		417	Putative cytochrome P450; P450 monooxygenase, oxid	98.19
1io7_A		368	Cytochrome P450 CYP119; thermophilic, cytochromo P	98.16
2uuq_A		414	CYP130, cytochrome P450 130; iron, heme, monooxyge	98.16
2xkr_A		398	CYP142, putative cytochrome P450 142; oxidoreducta	98.15
2wiy_A		394	XPLA-heme, cytochrome P450-like protein XPLA; CYT-	98.15
1ued_A		406	P450 OXYC, P450 monooxygenase; cytochrome P450 van	98.12
1q5d_A		419	P450 epoxidase; cytochrome P450, epothilone, oxydo	98.1
2zwu_A		415	Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl	98.07
1cpt_A		428	Cytochrome P450-TERP; oxidoreductase(oxygenase); H	98.07
3tkt_A		450	Cytochrome P450; aromatic hydrocarbon binding of P	98.06
2cd8_A		436	Cytochrome P450 monooxygenase; oxidoreductase, PIK	98.06
3abb_A		408	CYP105D6, cytochrome P450 hydroxylase; oxidoreduct	98.06
1lfk_A		398	OXYB, P450 monooxygenase; oxidative phenol couplin	98.06
2xbk_A		404	PIMD protein; epoxidation, oxidoreductase; HET: HE	98.06
3dan_A		473	Cytochrome P450 74A2; AOS heme cytochrome P450 str	98.04
3buj_A		397	CALO2; heme, iron, metal-binding, monooxygenase, o	98.03
1s1f_A		406	Putative cytochrome P450; cytochrome P450 oxidored	98.02
2z3t_A		425	Cytochrome P450; monoxygenase, oxydoreductase, hem	98.01
1gwi_A		411	CYP154C1, cytochrome P450 154C1; oxidoreductase, m	98.0
3qz1_A		496	Steroid 21-hydroxylase; P450 monooxygenase, oxidor	98.0
3ld6_A		461	Lanosterol 14-alpha demethylase; cytochrome P450,	98.0
1z8o_A		404	6-deoxyerythronolide B hydroxylase; heme, CYP, ery	97.96
3ivy_A		433	Cytochrome P450 CYP125; cholesterol, monooxygenase	97.92
2hi4_A		495	Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m	97.9
3aba_A		403	Cytochrome P450; oxidoreductase, heme, monooxygena	97.9
3a4g_A		411	Vitamin D hydroxylase; cytochrome P450, hemoprotei	97.89
2z36_A		413	MOXA, cytochrome P450 type compactin 3'',4''- hydr	97.88
3dsk_A		495	Cytochrome P450 74A, chloroplast; P450 fold, fatty	97.86
3i3k_A		461	Lanosterol 14-alpha demethylase; cytochrome P450,	97.82
3p3o_A		416	Cytochrome P450; monooxygenase, oxidoreductase; HE	97.81
2y5n_A		417	MYCG, P-450-like protein; oxidoreductase, mycinami	97.8
3mgx_A		415	Putative P450 monooxygenase; cytochrome P450 oxida	97.8
2rfb_A		343	Cytochrome P450; heme, iron, metal-binding, monoox	97.8
1n40_A		396	P450 MT2, cytochrome P450 121; heme binding, oxyge	97.75
3rwl_A		426	Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45	97.74
3r9b_A		418	Cytochrome P450 164A2; monooxygenase, oxidoreducta	97.68
3ejb_B		404	Biotin biosynthesis cytochrome P450-like enzyme; p	97.67
3nc3_A		441	Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE	97.67
2jjn_A		411	Cytochrome P450 113A1; oxidoreductase, iron, heme,	97.65
4fb2_A		398	P450CIN; heme, monooxygenase, cindoxin, oxidoreduc	97.6
3b4x_A		367	367AA long hypothetical cytochrome P450; HEM prote	97.49
3oft_A		396	Cytochrome P450, CYP101C1; oxidoreductase; HET: HE	97.25
3v8d_A		491	Cholesterol 7-alpha-monooxygenase; cytochrome, oxi	97.16
3tbg_A		479	Cytochrome P450 2D6; monooxygenase, thioridazine,	97.11
3lxh_A		421	Cytochrome P450; heme, iron, metal-binding, monoox	96.95
4dxy_A		417	Cytochrome P450, CYP101D2; cytochrome P450 mutant,	96.88
4dnj_A		412	Putative cytochrome P450; oxidoreductase; HET: HEM	96.86
3dax_A		491	Cytochrome P450 7A1; cholesterol, cholesterol 7-al	96.32
3b98_A		475	Prostaglandin I2 synthase; prostacyclin synthase,	95.62
3b6h_A		498	Prostacyclin synthase; enzyme-inhibitor complex, C	95.46
2yjn_B		381	Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase;	84.23

>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A*	Back alignment and structure

Probab=99.05  E-value=8e-10  Score=73.59  Aligned_cols=81  Identities=27%  Similarity=0.335  Sum_probs=68.6

Q ss_pred             CCCCCChHhHHHHHHHHHHHHHHHHHHHhhhcC-CCceehhHHHHHHHHHHHHHHhhcccccccCCCccHHHHHHHHHHH
Q psy16906          2 ITPTFHFKILDVFVDVFVEKCQILVDKLGDKCD-GKAFDVYPFITRCAMDIICETAMGIEINAQRDSKSDYVRAVYEISE   80 (120)
Q Consensus         2 l~p~fs~~~l~~~~~~~~~~~~~l~~~l~~~~~-~~~vd~~~~~~~~~~dvi~~~~fg~~~~~~~~~~~~~~~~~~~~~~   80 (120)
                      ++|+|++++++.+.|.+.++++.+++.|.+... +.++|+.+++..+++|+|++++||.+++.......++...+..+..
T Consensus        93 ~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~~~~vd~~~~~~~~~~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~  172 (456)
T 3mdm_A           93 IDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLE  172 (456)
T ss_dssp             HGGGGSHHHHHTTHHHHHHHHHHHHHHHHHTCSSSSCEEHHHHHHHHHHHHHHHHHHSCCCCGGGTCCHHHHHHHHHHHH
T ss_pred             cccccCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCeeeHHHHHHHHHHHHHHHHHcCCChhhhcccccHHHHHHHHHHH
Confidence            579999999999999999999999999987654 6789999999999999999999999987765545566666666555


Q ss_pred             HH
Q psy16906         81 LT   82 (120)
Q Consensus        81 ~~   82 (120)
                      ..
T Consensus       173 ~~  174 (456)
T 3mdm_A          173 GI  174 (456)
T ss_dssp             HH
T ss_pred             HH
Confidence            43

PyMOL of 3mdm

>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ...	Back alignment and structure

>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A*	Back alignment and structure

>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A*	Back alignment and structure

>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A*	Back alignment and structure

>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A*	Back alignment and structure

>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A*	Back alignment and structure

>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A*	Back alignment and structure

>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A*	Back alignment and structure

>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A*	Back alignment and structure

>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A*	Back alignment and structure

>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A*	Back alignment and structure

>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A*	Back alignment and structure

>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A*	Back alignment and structure

>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A*	Back alignment and structure

>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A*	Back alignment and structure

>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A*	Back alignment and structure

>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A*	Back alignment and structure

>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1	Back alignment and structure

>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A*	Back alignment and structure

>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens}	Back alignment and structure

>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A*	Back alignment and structure

>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A*	Back alignment and structure

>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A*	Back alignment and structure

>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A*	Back alignment and structure

>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A*	Back alignment and structure

>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A*	Back alignment and structure

>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A*	Back alignment and structure

>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A*	Back alignment and structure

>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis}	Back alignment and structure

>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A*	Back alignment and structure

>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1	Back alignment and structure

>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A*	Back alignment and structure

>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ...	Back alignment and structure

>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1	Back alignment and structure

>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans}	Back alignment and structure

>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A*	Back alignment and structure

>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis}	Back alignment and structure

>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A*	Back alignment and structure

>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A*	Back alignment and structure

>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A*	Back alignment and structure

>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora}	Back alignment and structure

>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A*	Back alignment and structure

>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A*	Back alignment and structure

>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1	Back alignment and structure

>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus}	Back alignment and structure

>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A*	Back alignment and structure

>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A*	Back alignment and structure

>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A*	Back alignment and structure

>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens}	Back alignment and structure

>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A*	Back alignment and structure

>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A*	Back alignment and structure

>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena}	Back alignment and structure

>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A*	Back alignment and structure

>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A*	Back alignment and structure

>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A*	Back alignment and structure

>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina}	Back alignment and structure

>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A*	Back alignment and structure

>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A*	Back alignment and structure

>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida}	Back alignment and structure

>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A*	Back alignment and structure

>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B*	Back alignment and structure

>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A*	Back alignment and structure

>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A*	Back alignment and structure

>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A*	Back alignment and structure

>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A*	Back alignment and structure

>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A*	Back alignment and structure

>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A*	Back alignment and structure

>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A*	Back alignment and structure

>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A*	Back alignment and structure

>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A*	Back alignment and structure

>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A*	Back alignment and structure

>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A*	Back alignment and structure

>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A*	Back alignment and structure

>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A*	Back alignment and structure

>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		120
d3czha1		463	a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2	0.002

>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463	Back information, alignment and structure


class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.3 bits (77), Expect = 0.002
 Identities = 13/99 (13%), Positives = 27/99 (27%)

Query: 1   MITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIE 60
            +    +F       +  + +     +   +   G+ FD    IT    +I      G  
Sbjct: 101 AVNSFRYFGYGQKSFESKILEETKFFNDAIETYKGRPFDFKQLITNAVSNITNLIIFGER 160

Query: 61  INAQRDSKSDYVRAVYEISELTIVRSLRPWLWHPLVFKW 99
              +       +    E  EL    S+  +   P +   
Sbjct: 161 FTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGIL 199

PyMOL of d3czha1

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		120
d2ij2a1		453	Cytochrome P450 bm-3 {Bacillus megaterium [TaxId:	99.05
d1n97a_		385	Cyp175a1 {Thermus thermophilus [TaxId: 274]}	98.69
d1tqna_		472	Mammalian cytochrome P450 3a4 {Human (Homo sapiens	98.66
d2ciba1		445	Cytochrome p450 14 alpha-sterol demethylase (cyp51	98.52
d1jfba_		399	Cytochrome P450-NOR, nitric reductase {Fungus (Fus	98.03
d1odoa_		401	Cyp154a1 monooxygenase {Streptomyces coelicolor [T	98.0
d1ueda_		403	p450 monoxygenase OxyC {Amycolatopsis orientalis [	97.73
d1lfka_		394	p450 monoxygenase OxyB {Amycolatopsis orientalis [	97.68
d1izoa_		411	Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis	97.53
d1z8oa1		402	Cytochrome P450-ERYF {Saccharopolyspora erythraea	97.39
d1s1fa_		399	Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]}	97.23
d1re9a_		404	Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30	97.07
d1gwia_		403	Cyp154c1 monooxygenase {Streptomyces coelicolor [T	96.85
d1io7a_		366	Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2	96.66
d1cpta_		428	Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]	96.65
d1n40a_		395	Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub	96.38
d3czha1		463	Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie	96.22
d1q5da_		401	Cytochrome P450epok {Sorangium cellulosum [TaxId:	96.0
d1r9oa_		467	Mammalian cytochrome p450 2c9 {Human (Homo sapiens	94.29
d1po5a_		465	Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus	91.36
d1ue8a_		367	Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195	90.34

>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}	Back information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450 bm-3
species: Bacillus megaterium [TaxId: 1404]

Probab=99.05  E-value=1.2e-10  Score=75.94  Aligned_cols=76  Identities=16%  Similarity=0.239  Sum_probs=61.8

Q ss_pred             CCCCCChHhHHHHHHHHHHHHHHHHHHHhhhcCCCceehhHHHHHHHHHHHHHHhhcccccccCC-CccHHHHHHHH
Q psy16906          2 ITPTFHFKILDVFVDVFVEKCQILVDKLGDKCDGKAFDVYPFITRCAMDIICETAMGIEINAQRD-SKSDYVRAVYE   77 (120)
Q Consensus         2 l~p~fs~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~vd~~~~~~~~~~dvi~~~~fg~~~~~~~~-~~~~~~~~~~~   77 (120)
                      +.|.|++++++.+.+.+.++++++++.|.+...++++|+.+++..+++|++++++||.+++.... ...+....+..
T Consensus       101 l~~~fs~~~l~~~~~~i~~~~~~li~~l~~~~~~~~idl~~~~~~~~~~~i~~~~fG~~~~~~~~~~~~~~~~~~~~  177 (453)
T d2ij2a1         101 LLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVR  177 (453)
T ss_dssp             HGGGGSTTTHHHHHHHHHHHHHHHHHHHHTCCTTCCEEHHHHHHHHHHHHHHHHHHSCCCCGGGCSSCCHHHHHHHH
T ss_pred             HHHHhhhhhhhhhhhhHHHHHHHHHHHhhhcCCCCccchHHHHHHHhhhcchhcccccccchhhhccchHHHHhhhh
Confidence            57899999999999999999999999997643378999999999999999999999998865533 23444443333

PyMOL of d2ij2a1

>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}	Back information, alignment and structure

>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]}	Back information, alignment and structure

>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]}	Back information, alignment and structure

>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure