Diaphorina citri psyllid: psy16910


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MNNSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSEVGFQNR
ccccEEEEEEEccccccccEEEEcccccEEEEEccccHHHccccccccccccccccHHHHHHcccccccccEEEEEEEEccc
*NNSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSEVGF***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSEVGFQNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase TEL1 Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates histone H2A to form H2AS128ph (gamma-H2A) at sites of DNA damage, involved in the regulation of DNA damage response mechanism. Required for the control of telomere length and genome stability.confidentP0CP60
DNA-dependent protein kinase catalytic subunit Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism.confidentQ8QGX4
Serine/threonine-protein kinase TEL1 Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates histone H2A to form H2AS128ph (gamma-H2A) at sites of DNA damage, involved in the regulation of DNA damage response mechanism. Required for the control of telomere length and genome stability.confidentQ4IB89

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006302 [BP]double-strand break repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005958 [CC]DNA-dependent protein kinase-DNA ligase 4 complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0070419
GO:0006975 [BP]DNA damage induced protein phosphorylationprobableGO:0016310, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0071704, GO:0006468, GO:0009987, GO:0006464, GO:0006974, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0044238, GO:0019538, GO:0050896, GO:0006950, GO:0044237, GO:0043170, GO:0006796, GO:0033554, GO:0006793, GO:0008150
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0042162 [MF]telomeric DNA bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0004677 [MF]DNA-dependent protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010332 [BP]response to gamma radiationprobableGO:0008150, GO:0009314, GO:0050896, GO:0010212, GO:0009628
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031648 [BP]protein destabilizationprobableGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HHM, chain A
Confidence level:very confident
Coverage over the Query: 3-40,52-79
View the alignment between query and template
View the model in PyMOL