Psyllid ID: psy16910
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| 189234155 | 2349 | PREDICTED: similar to protein kinase, DN | 0.695 | 0.024 | 0.631 | 2e-17 | |
| 270002715 | 3670 | hypothetical protein TcasGA2_TC016161 [T | 0.695 | 0.015 | 0.631 | 2e-17 | |
| 339241493 | 418 | DNA-dependent protein kinase catalytic s | 0.792 | 0.155 | 0.597 | 1e-14 | |
| 384485391 | 1980 | hypothetical protein RO3G_02275 [Rhizopu | 0.756 | 0.031 | 0.569 | 4e-14 | |
| 111226581 | 4299 | DNA-dependent protein kinase subunit [Di | 0.695 | 0.013 | 0.614 | 2e-13 | |
| 328701273 | 673 | PREDICTED: DNA-dependent protein kinase | 0.658 | 0.080 | 0.592 | 2e-13 | |
| 302832167 | 3901 | hypothetical protein VOLCADRAFT_87995 [V | 0.731 | 0.015 | 0.583 | 2e-13 | |
| 290995959 | 4423 | DNA dependent protein kinase catalytic s | 0.658 | 0.012 | 0.629 | 5e-13 | |
| 390355670 | 1675 | PREDICTED: DNA-dependent protein kinase | 0.658 | 0.032 | 0.666 | 8e-13 | |
| 390355668 | 1974 | PREDICTED: DNA-dependent protein kinase | 0.658 | 0.027 | 0.666 | 8e-13 |
| >gi|189234155|ref|XP_970757.2| PREDICTED: similar to protein kinase, DNA activated, catalytic polypeptide [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 93.2 bits (230), Expect = 2e-17, Method: Composition-based stats.
Identities = 36/57 (63%), Positives = 49/57 (85%)
Query: 12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGS 68
+GDRHL N+LVC +G+ +GIDFG++FG ATQ+LP+PEL+PFRLTPHI+ + EP G+
Sbjct: 2147 VGDRHLSNSLVCLNSGKVLGIDFGHAFGTATQILPVPELVPFRLTPHIVNLMEPLGA 2203
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270002715|gb|EEZ99162.1| hypothetical protein TcasGA2_TC016161 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|339241493|ref|XP_003376672.1| DNA-dependent protein kinase catalytic subunit [Trichinella spiralis] gi|316974599|gb|EFV58083.1| DNA-dependent protein kinase catalytic subunit [Trichinella spiralis] | Back alignment and taxonomy information |
|---|
| >gi|384485391|gb|EIE77571.1| hypothetical protein RO3G_02275 [Rhizopus delemar RA 99-880] | Back alignment and taxonomy information |
|---|
| >gi|111226581|ref|XP_640856.2| DNA-dependent protein kinase subunit [Dictyostelium discoideum AX4] gi|122086252|sp|Q54UC0.2|PRKDC_DICDI RecName: Full=DNA-dependent protein kinase catalytic subunit; Short=DNA-PK catalytic subunit; Short=DNA-PKcs gi|90970659|gb|EAL66880.2| DNA-dependent protein kinase subunit [Dictyostelium discoideum AX4] | Back alignment and taxonomy information |
|---|
| >gi|328701273|ref|XP_003241549.1| PREDICTED: DNA-dependent protein kinase catalytic subunit-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|302832167|ref|XP_002947648.1| hypothetical protein VOLCADRAFT_87995 [Volvox carteri f. nagariensis] gi|300266996|gb|EFJ51181.1| hypothetical protein VOLCADRAFT_87995 [Volvox carteri f. nagariensis] | Back alignment and taxonomy information |
|---|
| >gi|290995959|ref|XP_002680550.1| DNA dependent protein kinase catalytic subunit [Naegleria gruberi] gi|284094171|gb|EFC47806.1| DNA dependent protein kinase catalytic subunit [Naegleria gruberi] | Back alignment and taxonomy information |
|---|
| >gi|390355670|ref|XP_003728605.1| PREDICTED: DNA-dependent protein kinase catalytic subunit-like isoform 1 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|390355668|ref|XP_781813.3| PREDICTED: DNA-dependent protein kinase catalytic subunit-like isoform 2 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 82 | ||||||
| DICTYBASE|DDB_G0281167 | 4299 | dnapkcs "DNA-dependent protein | 0.695 | 0.013 | 0.614 | 2.8e-12 | |
| ZFIN|ZDB-GENE-030131-9008 | 4119 | wu:fa96e12 "wu:fa96e12" [Danio | 0.658 | 0.013 | 0.592 | 1.5e-11 | |
| MGI|MGI:104779 | 4128 | Prkdc "protein kinase, DNA act | 0.658 | 0.013 | 0.592 | 2.5e-11 | |
| UNIPROTKB|F1Q3H1 | 4135 | PRKDC "DNA-dependent protein k | 0.768 | 0.015 | 0.539 | 5e-11 | |
| UNIPROTKB|Q8WN22 | 4144 | PRKDC "DNA-dependent protein k | 0.768 | 0.015 | 0.539 | 5e-11 | |
| UNIPROTKB|Q9DEI1 | 4146 | prkdc "DNA-dependent protein k | 0.658 | 0.013 | 0.592 | 5e-11 | |
| UNIPROTKB|E7EUY0 | 4096 | PRKDC "DNA-dependent protein k | 0.658 | 0.013 | 0.592 | 5.1e-11 | |
| UNIPROTKB|P78527 | 4128 | PRKDC "DNA-dependent protein k | 0.658 | 0.013 | 0.592 | 5.1e-11 | |
| UNIPROTKB|F1RSE6 | 4133 | F1RSE6 "Uncharacterized protei | 0.658 | 0.013 | 0.592 | 6.5e-11 | |
| UNIPROTKB|F1NQD1 | 4134 | PRKDC "DNA-dependent protein k | 0.658 | 0.013 | 0.592 | 1.1e-10 |
| DICTYBASE|DDB_G0281167 dnapkcs "DNA-dependent protein kinase catalytic subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Score = 184 (69.8 bits), Expect = 2.8e-12, P = 2.8e-12
Identities = 35/57 (61%), Positives = 41/57 (71%)
Query: 12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGS 68
IGDRHLEN L+ + GR +GIDFG++FG ATQ LPIPELMPFRLT + P S
Sbjct: 4093 IGDRHLENFLISQRDGRLIGIDFGHAFGTATQFLPIPELMPFRLTRQFTSFLRPLDS 4149
|
|
| ZFIN|ZDB-GENE-030131-9008 wu:fa96e12 "wu:fa96e12" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:104779 Prkdc "protein kinase, DNA activated, catalytic polypeptide" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q3H1 PRKDC "DNA-dependent protein kinase catalytic subunit" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WN22 PRKDC "DNA-dependent protein kinase catalytic subunit" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9DEI1 prkdc "DNA-dependent protein kinase catalytic subunit" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EUY0 PRKDC "DNA-dependent protein kinase catalytic subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P78527 PRKDC "DNA-dependent protein kinase catalytic subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RSE6 F1RSE6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQD1 PRKDC "DNA-dependent protein kinase catalytic subunit" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| cd05172 | 235 | cd05172, PIKKc_DNA-PK, DNA-dependent protein kinas | 2e-27 | |
| smart00146 | 240 | smart00146, PI3Kc, Phosphoinositide 3-kinase, cata | 2e-16 | |
| cd05164 | 222 | cd05164, PIKKc, Phosphoinositide 3-kinase-related | 2e-15 | |
| pfam00454 | 233 | pfam00454, PI3_PI4_kinase, Phosphatidylinositol 3- | 2e-15 | |
| cd00892 | 237 | cd00892, PIKKc_ATR, ATR (Ataxia telangiectasia and | 4e-13 | |
| cd05171 | 279 | cd05171, PIKKc_ATM, Ataxia telangiectasia mutated | 1e-12 | |
| cd00142 | 219 | cd00142, PI3Kc_like, Phosphoinositide 3-kinase (PI | 2e-12 | |
| COG5032 | 2105 | COG5032, TEL1, Phosphatidylinositol kinase and pro | 6e-11 | |
| cd05169 | 280 | cd05169, PIKKc_TOR, TOR (Target of rapamycin), cat | 6e-10 | |
| cd05170 | 307 | cd05170, PIKKc_SMG1, Suppressor of morphogenetic e | 6e-08 | |
| cd00896 | 350 | cd00896, PI3Kc_III, Phosphoinositide 3-kinase (PI3 | 4e-07 | |
| cd00891 | 352 | cd00891, PI3Kc, Phosphoinositide 3-kinase (PI3K), | 4e-06 | |
| cd00894 | 365 | cd00894, PI3Kc_IB_gamma, Phosphoinositide 3-kinase | 1e-05 | |
| cd05165 | 366 | cd05165, PI3Kc_I, Phosphoinositide 3-kinase (PI3K) | 6e-04 | |
| cd05173 | 362 | cd05173, PI3Kc_IA_beta, Phosphoinositide 3-kinase | 0.004 |
| >gnl|CDD|119432 cd05172, PIKKc_DNA-PK, DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
Score = 98.9 bits (247), Expect = 2e-27
Identities = 37/57 (64%), Positives = 43/57 (75%)
Query: 12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGS 68
IGDRHL N LV +TG VGIDFG++FG ATQ LPIPELMPFRLTP + + EP +
Sbjct: 140 IGDRHLSNFLVDLETGGLVGIDFGHAFGTATQFLPIPELMPFRLTPQFVNLMEPMKA 196
|
DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double strand breaks (DSBs) by joining together two free DNA ends of little homology. DNA-PK functions as a molecular sensor for DNA damage that enhances the signal via phosphorylation of downstream targets. It may also act as a protein scaffold that aids the localization of DNA repair proteins to the site of DNA damage. DNA-PK also plays a role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Length = 235 |
| >gnl|CDD|214538 smart00146, PI3Kc, Phosphoinositide 3-kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|119424 cd05164, PIKKc, Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|189554 pfam00454, PI3_PI4_kinase, Phosphatidylinositol 3- and 4-kinase | Back alignment and domain information |
|---|
| >gnl|CDD|119418 cd00892, PIKKc_ATR, ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119431 cd05171, PIKKc_ATM, Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119416 cd00142, PI3Kc_like, Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|227365 COG5032, TEL1, Phosphatidylinositol kinase and protein kinases of the PI-3 kinase family [Signal transduction mechanisms / Cell division and chromosome partitioning / Chromatin structure and dynamics / DNA replication, recombination, and repair / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|119429 cd05169, PIKKc_TOR, TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119430 cd05170, PIKKc_SMG1, Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119422 cd00896, PI3Kc_III, Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119417 cd00891, PI3Kc, Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119420 cd00894, PI3Kc_IB_gamma, Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119425 cd05165, PI3Kc_I, Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >gnl|CDD|119433 cd05173, PI3Kc_IA_beta, Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| cd05172 | 235 | PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK) | 99.97 | |
| cd05169 | 280 | PIKKc_TOR TOR (Target of rapamycin), catalytic dom | 99.97 | |
| cd05163 | 253 | TRRAP TRansformation/tRanscription domain-Associat | 99.97 | |
| cd05171 | 279 | PIKKc_ATM Ataxia telangiectasia mutated (ATM), cat | 99.97 | |
| cd05170 | 307 | PIKKc_SMG1 Suppressor of morphogenetic effect on g | 99.97 | |
| cd00892 | 237 | PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-rela | 99.96 | |
| cd05164 | 222 | PIKKc Phosphoinositide 3-kinase-related protein ki | 99.96 | |
| cd00142 | 219 | PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like f | 99.96 | |
| smart00146 | 202 | PI3Kc Phosphoinositide 3-kinase, catalytic domain. | 99.95 | |
| cd05168 | 293 | PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), T | 99.95 | |
| cd00893 | 289 | PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type I | 99.94 | |
| KOG0890|consensus | 2382 | 99.94 | ||
| cd05165 | 366 | PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, | 99.94 | |
| cd00891 | 352 | PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic | 99.94 | |
| KOG0892|consensus | 2806 | 99.93 | ||
| cd05167 | 311 | PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), | 99.93 | |
| cd00894 | 365 | PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), c | 99.93 | |
| cd00896 | 350 | PI3Kc_III Phosphoinositide 3-kinase (PI3K), class | 99.93 | |
| PF00454 | 235 | PI3_PI4_kinase: Phosphatidylinositol 3- and 4-kina | 99.92 | |
| COG5032 | 2105 | TEL1 Phosphatidylinositol kinase and protein kinas | 99.92 | |
| cd05173 | 362 | PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), cl | 99.92 | |
| cd05174 | 361 | PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), c | 99.92 | |
| cd05166 | 353 | PI3Kc_II Phosphoinositide 3-kinase (PI3K), class I | 99.91 | |
| cd05175 | 366 | PI3Kc_IA_alpha Phosphoinositide 3-kinase (PI3K), c | 99.91 | |
| cd05176 | 353 | PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), c | 99.91 | |
| cd05177 | 354 | PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), c | 99.91 | |
| cd00895 | 354 | PI3Kc_C2_beta Phosphoinositide 3-kinase (PI3K), cl | 99.89 | |
| KOG0904|consensus | 1076 | 99.8 | ||
| KOG0903|consensus | 847 | 99.75 | ||
| KOG0906|consensus | 843 | 99.74 | ||
| KOG0891|consensus | 2341 | 99.65 | ||
| KOG0902|consensus | 1803 | 99.59 | ||
| KOG0905|consensus | 1639 | 99.59 | ||
| PTZ00303 | 1374 | phosphatidylinositol kinase; Provisional | 99.47 | |
| KOG0889|consensus | 3550 | 98.9 | ||
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 92.57 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 92.36 | |
| cd05151 | 170 | ChoK Choline Kinase (ChoK). The ChoK subfamily is | 91.39 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 91.13 | |
| COG0661 | 517 | AarF Predicted unusual protein kinase [General fun | 91.02 | |
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 90.71 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 89.67 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 89.45 | |
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 89.42 | |
| TIGR03843 | 253 | conserved hypothetical protein. This model represe | 89.21 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 89.02 | |
| PF01636 | 239 | APH: Phosphotransferase enzyme family This family | 88.92 | |
| cd05156 | 302 | ChoK_euk Choline Kinase (ChoK) in eukaryotes. The | 88.48 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 87.77 | |
| KOG0616|consensus | 355 | 87.21 | ||
| smart00090 | 237 | RIO RIO-like kinase. | 86.41 | |
| PRK01723 | 239 | 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | 86.07 | |
| PF01633 | 211 | Choline_kinase: Choline/ethanolamine kinase; Inter | 84.71 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 84.46 | |
| PLN02421 | 330 | phosphotransferase, alcohol group as acceptor/kina | 84.41 | |
| KOG0608|consensus | 1034 | 83.36 | ||
| cd05157 | 235 | ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. | 83.18 | |
| KOG0984|consensus | 282 | 82.52 | ||
| cd05154 | 223 | ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an | 81.96 | |
| cd05153 | 296 | HomoserineK_II Homoserine Kinase, type II. Homoser | 81.85 | |
| KOG0598|consensus | 357 | 81.18 | ||
| PRK12274 | 218 | serine/threonine protein kinase; Provisional | 81.08 |
| >cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
Probab=99.97 E-value=2e-33 Score=200.73 Aligned_cols=75 Identities=51% Similarity=0.747 Sum_probs=71.0
Q ss_pred ccceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCchheeeeE
Q psy16910 2 NNSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQEVALSSE 76 (82)
Q Consensus 2 ~~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG~f~~~~ 76 (82)
..|++||++|||||||+|||+++.||+++|||||++|+.+++.+++||.|||||||||+++||+.|+||.|++++
T Consensus 130 ~~S~~~YilglgDRH~~NIli~~~tG~v~HIDfg~~f~~~~~~~~~pE~vPFRLT~~~~~~~g~~g~~G~f~~~~ 204 (235)
T cd05172 130 AMCVSHWILGIGDRHLSNFLVDLETGGLVGIDFGHAFGTATQFLPIPELMPFRLTPQFVNLMEPMKADGLLRSCM 204 (235)
T ss_pred HHHHHhheeeccCCCcccEEEECCCCcEEEEeeHhhhccCCccCCCCCCCCeeeCHHHHHHhCCCCCCChHHHHH
Confidence 368999999999999999999999999999999999999988889999999999999999999999999998643
|
DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st |
| >cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05163 TRRAP TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd05168 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd00893 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >KOG0890|consensus | Back alignment and domain information |
|---|
| >cd05165 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >KOG0892|consensus | Back alignment and domain information |
|---|
| >cd05167 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd00894 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd00896 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >PF00454 PI3_PI4_kinase: Phosphatidylinositol 3- and 4-kinase; InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >COG5032 TEL1 Phosphatidylinositol kinase and protein kinases of the PI-3 kinase family [Signal transduction mechanisms / Cell division and chromosome partitioning / Chromatin structure and dynamics / DNA replication, recombination, and repair / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd05173 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05174 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), class IA, delta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05166 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class II, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05175 PI3Kc_IA_alpha Phosphoinositide 3-kinase (PI3K), class IA, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05176 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), class II, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd05177 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), class II, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >cd00895 PI3Kc_C2_beta Phosphoinositide 3-kinase (PI3K), class II, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases | Back alignment and domain information |
|---|
| >KOG0904|consensus | Back alignment and domain information |
|---|
| >KOG0903|consensus | Back alignment and domain information |
|---|
| >KOG0906|consensus | Back alignment and domain information |
|---|
| >KOG0891|consensus | Back alignment and domain information |
|---|
| >KOG0902|consensus | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >PTZ00303 phosphatidylinositol kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0889|consensus | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >cd05151 ChoK Choline Kinase (ChoK) | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >COG0661 AarF Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >TIGR03843 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily | Back alignment and domain information |
|---|
| >cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >PLN02421 phosphotransferase, alcohol group as acceptor/kinase | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes | Back alignment and domain information |
|---|
| >KOG0984|consensus | Back alignment and domain information |
|---|
| >cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins | Back alignment and domain information |
|---|
| >cd05153 HomoserineK_II Homoserine Kinase, type II | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >PRK12274 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 82 | ||||
| 1e8y_A | 966 | Structure Determinants Of Phosphoinositide 3-Kinase | 2e-04 | ||
| 1he8_A | 965 | Ras G12v-Pi 3-Kinase Gamma Complex Length = 965 | 2e-04 | ||
| 4dk5_A | 959 | Crystal Structure Of Human Pi3k-Gamma In Complex Wi | 2e-04 | ||
| 4anv_A | 980 | Complexes Of Pi3kgamma With Isoform Selective Inhib | 2e-04 | ||
| 4anu_A | 980 | Complexes Of Pi3kgamma With Isoform Selective Inhib | 2e-04 | ||
| 3apc_A | 966 | Crystal Structure Of Human Pi3k-Gamma In Complex Wi | 2e-04 | ||
| 3qaq_A | 960 | Crystal Structure Of Pi3k-Gamma In Complex With Tri | 2e-04 | ||
| 3nzs_A | 954 | Structure-Based Optimization Of Pyrazolo -Pyrimidin | 2e-04 | ||
| 3l54_A | 966 | Structure Of Pi3k Gamma With Inhibitor Length = 966 | 2e-04 | ||
| 3ene_A | 959 | Complex Of Pi3k Gamma With An Inhibitor Length = 95 | 2e-04 | ||
| 3dbs_A | 960 | Structure Of Pi3k Gamma In Complex With Gdc0941 Len | 2e-04 | ||
| 3cst_A | 966 | Crystal Structure Of Pi3k P110gamma Catalytical Dom | 2e-04 | ||
| 4anx_A | 980 | Complexes Of Pi3kgamma With Isoform Selective Inhib | 6e-04 |
| >pdb|1E8Y|A Chain A, Structure Determinants Of Phosphoinositide 3-Kinase Inhibition By Wortmannin, Ly294002, Quercetin, Myricetin And Staurosporine Length = 966 | Back alignment and structure |
|
| >pdb|1HE8|A Chain A, Ras G12v-Pi 3-Kinase Gamma Complex Length = 965 | Back alignment and structure |
| >pdb|4DK5|A Chain A, Crystal Structure Of Human Pi3k-Gamma In Complex With A Pyridyl- Triazine Inhibitor Length = 959 | Back alignment and structure |
| >pdb|4ANV|A Chain A, Complexes Of Pi3kgamma With Isoform Selective Inhibitors Length = 980 | Back alignment and structure |
| >pdb|4ANU|A Chain A, Complexes Of Pi3kgamma With Isoform Selective Inhibitors. Length = 980 | Back alignment and structure |
| >pdb|3APC|A Chain A, Crystal Structure Of Human Pi3k-Gamma In Complex With Ch5132799 Length = 966 | Back alignment and structure |
| >pdb|3QAQ|A Chain A, Crystal Structure Of Pi3k-Gamma In Complex With Triazine-Benzimidazole 1 Length = 960 | Back alignment and structure |
| >pdb|3NZS|A Chain A, Structure-Based Optimization Of Pyrazolo -Pyrimidine And -Pyridine Inhibitors Of Pi3-Kinase Length = 954 | Back alignment and structure |
| >pdb|3L54|A Chain A, Structure Of Pi3k Gamma With Inhibitor Length = 966 | Back alignment and structure |
| >pdb|3ENE|A Chain A, Complex Of Pi3k Gamma With An Inhibitor Length = 959 | Back alignment and structure |
| >pdb|3DBS|A Chain A, Structure Of Pi3k Gamma In Complex With Gdc0941 Length = 960 | Back alignment and structure |
| >pdb|3CST|A Chain A, Crystal Structure Of Pi3k P110gamma Catalytical Domain In Complex With Organoruthenium Inhibitor E5e2 Length = 966 | Back alignment and structure |
| >pdb|4ANX|A Chain A, Complexes Of Pi3kgamma With Isoform Selective Inhibitors Length = 980 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 82 | |||
| 3ls8_A | 614 | Phosphatidylinositol 3-kinase catalytic subunit ty | 6e-08 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 1e-07 | |
| 2x6h_A | 696 | GH13170P, VPS34, phosphotidylinositol 3 kinase 59F | 2e-07 | |
| 1e7u_A | 961 | Phosphatidylinositol 3-kinase catalytic subunit; p | 2e-07 | |
| 2y3a_A | 1092 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 3e-07 | |
| 3hhm_A | 1091 | Phosphatidylinositol-4,5-bisphosphate 3-kinase cat | 8e-07 |
| >3ls8_A Phosphatidylinositol 3-kinase catalytic subunit type 3; alpha/beta protein, PIK3C3, compound 15E, structural genomics, SGC stockholm; HET: AJZ; 2.25A {Homo sapiens} PDB: 3ihy_A Length = 614 | Back alignment and structure |
|---|
Score = 46.8 bits (110), Expect = 6e-08
Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 5/51 (9%)
Query: 12 IGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAV 62
+GDRHL+N L+ TKTG+ IDFGY G P P P +L ++
Sbjct: 476 VGDRHLDNLLL-TKTGKLFHIDFGYILGRD----PKPLPPPMKLNKEMVEG 521
|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Length = 940 | Back alignment and structure |
|---|
| >2x6h_A GH13170P, VPS34, phosphotidylinositol 3 kinase 59F; transferase; 2.90A {Drosophila melanogaster} PDB: 2x6f_A 2x6i_A* 2x6j_A* 2x6k_A* Length = 696 | Back alignment and structure |
|---|
| >2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 1092 | Back alignment and structure |
|---|
| >3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Length = 1091 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| 3ls8_A | 614 | Phosphatidylinositol 3-kinase catalytic subunit ty | 99.93 | |
| 2x6h_A | 696 | GH13170P, VPS34, phosphotidylinositol 3 kinase 59F | 99.93 | |
| 1e7u_A | 961 | Phosphatidylinositol 3-kinase catalytic subunit; p | 99.93 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 99.91 | |
| 2y3a_A | 1092 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 99.91 | |
| 3hhm_A | 1091 | Phosphatidylinositol-4,5-bisphosphate 3-kinase cat | 99.9 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 86.61 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 85.06 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 84.85 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 84.32 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 83.23 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 82.83 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 82.44 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 81.19 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 80.5 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 80.1 |
| >3ls8_A Phosphatidylinositol 3-kinase catalytic subunit type 3; alpha/beta protein, PIK3C3, compound 15E, structural genomics, SGC stockholm; HET: AJZ; 2.25A {Homo sapiens} PDB: 3ihy_A | Back alignment and structure |
|---|
Probab=99.93 E-value=1.7e-28 Score=193.22 Aligned_cols=72 Identities=29% Similarity=0.443 Sum_probs=64.8
Q ss_pred cceeeeeeeeCCCCCCcEEEEcCCCcEEEEeeceeeccccCCCCCCCCCceeecHHHHHhhCCCCCch--hee-eeEEee
Q psy16910 3 NSSLLLEYSIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNEPYGSQE--VAL-SSEVGF 79 (82)
Q Consensus 3 ~S~~~yilgigDRh~~nili~~~tG~v~hiDfg~~~~~~~~~~~~~E~vPFRLT~~~~~~~g~~g~eG--~f~-~~~~~~ 79 (82)
.|++|||||||||||+||||+ .||+++|||||++|+.++ .||+||||||++|+++||+.|+|| .|+ .|+.++
T Consensus 467 ySvv~YILGigDRH~~NILld-~tG~v~HIDFG~~f~~~p----~pe~vPFRLT~~mv~~mG~~~~e~f~~Fr~~c~~~~ 541 (614)
T 3ls8_A 467 YCVITYILGVGDRHLDNLLLT-KTGKLFHIDFGYILGRDP----KPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAF 541 (614)
T ss_dssp HHHHHHHHTCCCCCTTSEEEC-TTSCEEECCCSSCTTCCS----SSSCCSSCCCHHHHHHTTCTTSHHHHHHHHHHHHHH
T ss_pred HhHhheeeeccCCCCcceeEc-CCCCEeeeehHHhhccCC----CCCCCCeecCHHHHHHhCCCCCchHHHHHHHHHHHH
Confidence 489999999999999999998 899999999999999874 489999999999999999999998 787 455444
|
| >2x6h_A GH13170P, VPS34, phosphotidylinositol 3 kinase 59F; transferase; 2.90A {Drosophila melanogaster} PDB: 2x6f_A 2x6i_A* 2x6j_A* 2x6k_A* | Back alignment and structure |
|---|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* | Back alignment and structure |
|---|
| >2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 82 | ||||
| d1e7ua4 | 369 | d.144.1.4 (A:726-1094) Phoshoinositide 3-kinase (P | 1e-10 |
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 82 | |||
| d1e7ua4 | 369 | Phoshoinositide 3-kinase (PI3K), catalytic domain | 99.94 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 90.63 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 88.21 | |
| d1zaka2 | 31 | Microbial and mitochondrial ADK, insert "zinc fing | 85.88 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 83.87 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 81.2 |
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zaka2 g.41.2.1 (A:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|