Diaphorina citri psyllid: psy16922


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKTSM
cccccEEHHccccEEHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccc
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKTSM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015824 [BP]proline transportprobableGO:0071705, GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0015804, GO:0044765, GO:0008150, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0015808 [BP]L-alanine transportprobableGO:0071705, GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0015804, GO:0044765, GO:0015807, GO:0008150, GO:0015849, GO:0032328, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0008324 [MF]cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DJK, chain A
Confidence level:confident
Coverage over the Query: 6-60
View the alignment between query and template
View the model in PyMOL