Psyllid ID: psy16922


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKTSM
cccccEEHHccccEEHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccc
ccHHHHHHHHHHHHHHHHHHHccccccHcccccHHHHHHHHHHHHHHHHHHHHHHEEcccccccEEEEccccccc
MFAQIEKNENLLTSKIVSLEnnmkqpadyrkpcgvfnIGMVFITCLYGFTGLVGYmkygaatqgsvtlnlpktsm
mfaqieknenlLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAatqgsvtlnlpktsm
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKTSM
**************************ADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSV*********
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLP****
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKTSM
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLP****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKTSM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
Q7Z2H8 476 Proton-coupled amino acid yes N/A 0.706 0.111 0.482 6e-07
Q4V8B1 477 Proton-coupled amino acid yes N/A 0.706 0.111 0.446 5e-06
Q495N2 470 Proton-coupled amino acid no N/A 0.706 0.112 0.428 5e-06
Q4KL91 522 Proton-coupled amino acid N/A N/A 0.746 0.107 0.406 1e-05
Q811P0 477 Proton-coupled amino acid yes N/A 0.706 0.111 0.428 1e-05
Q924A5 475 Proton-coupled amino acid no N/A 0.706 0.111 0.446 2e-05
Q8K4D3 475 Proton-coupled amino acid no N/A 0.706 0.111 0.446 3e-05
Q8K415 481 Proton-coupled amino acid no N/A 0.706 0.110 0.410 9e-05
Q8BHK3 478 Proton-coupled amino acid no N/A 0.706 0.110 0.410 0.0003
Q8CH36 500 Proton-coupled amino acid no N/A 0.72 0.108 0.368 0.0006
>sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query: 16  IVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLP 71
           ++ LEN MK P   RK   +  +GMV +T LY   G +GY+++GA  QGS+TLNLP
Sbjct: 275 VLPLENKMKDP---RKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLP 327




Neutral amino acid/proton symporter. Has a pH-dependent electrogenic transport activity for small amino acids such as glycine, alanine and proline. Besides small apolar L-amino acids, it also recognize their D-enantiomers and selected amino acid derivatives such as gamma-aminobutyric acid.
Homo sapiens (taxid: 9606)
>sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 Back     alignment and function description
>sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 Back     alignment and function description
>sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 Back     alignment and function description
>sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 Back     alignment and function description
>sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 Back     alignment and function description
>sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 Back     alignment and function description
>sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 Back     alignment and function description
>sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
194759424 452 GF15226 [Drosophila ananassae] gi|190615 0.76 0.126 0.543 6e-12
157123283 509 amino acid transporter [Aedes aegypti] g 0.76 0.111 0.543 1e-11
195397889 518 GJ18031 [Drosophila virilis] gi|19414121 0.76 0.110 0.526 4e-11
91094631 493 PREDICTED: similar to amino acid transpo 0.76 0.115 0.508 1e-10
195115691 519 GI17357 [Drosophila mojavensis] gi|19391 0.76 0.109 0.508 1e-10
270016446 1108 hypothetical protein TcasGA2_TC004406 [T 0.76 0.051 0.508 1e-10
157127446 506 amino acid transporter [Aedes aegypti] g 0.746 0.110 0.553 2e-10
157127444 489 amino acid transporter [Aedes aegypti] g 0.746 0.114 0.553 2e-10
317183301 528 SD03414p [Drosophila melanogaster] 0.76 0.107 0.508 2e-10
158296566 507 AGAP008490-PA [Anopheles gambiae str. PE 0.746 0.110 0.535 2e-10
>gi|194759424|ref|XP_001961949.1| GF15226 [Drosophila ananassae] gi|190615646|gb|EDV31170.1| GF15226 [Drosophila ananassae] Back     alignment and taxonomy information
 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%)

Query: 16  IVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPK 72
           ++ LENNM+ P D+  P GV N GMV + CLY   G  GY+KYG A +GS+TLNLP+
Sbjct: 312 VLPLENNMRTPEDFSGPTGVLNTGMVIVACLYTSVGFFGYLKYGDAVKGSITLNLPQ 368




Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157123283|ref|XP_001660096.1| amino acid transporter [Aedes aegypti] gi|108874408|gb|EAT38633.1| AAEL009479-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195397889|ref|XP_002057560.1| GJ18031 [Drosophila virilis] gi|194141214|gb|EDW57633.1| GJ18031 [Drosophila virilis] Back     alignment and taxonomy information
>gi|91094631|ref|XP_969879.1| PREDICTED: similar to amino acid transporter [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195115691|ref|XP_002002390.1| GI17357 [Drosophila mojavensis] gi|193912965|gb|EDW11832.1| GI17357 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|270016446|gb|EFA12892.1| hypothetical protein TcasGA2_TC004406 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157127446|ref|XP_001654984.1| amino acid transporter [Aedes aegypti] gi|108882419|gb|EAT46644.1| AAEL002214-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|157127444|ref|XP_001654983.1| amino acid transporter [Aedes aegypti] gi|108882418|gb|EAT46643.1| AAEL002214-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|317183301|gb|ADV15454.1| SD03414p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|158296566|ref|XP_316954.4| AGAP008490-PA [Anopheles gambiae str. PEST] gi|157014771|gb|EAA12852.4| AGAP008490-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
FB|FBgn0032036 504 CG13384 [Drosophila melanogast 0.76 0.113 0.508 2e-11
FB|FBgn0036116 465 CG7888 [Drosophila melanogaste 0.76 0.122 0.508 4.5e-10
FB|FBgn0036007 500 path "pathetic" [Drosophila me 0.746 0.112 0.482 2.3e-09
FB|FBgn0035300 451 CG1139 [Drosophila melanogaste 0.8 0.133 0.416 2.4e-09
FB|FBgn0030816 468 CG16700 [Drosophila melanogast 0.773 0.123 0.431 4.3e-09
WB|WBGene00016628 489 C44B7.6 [Caenorhabditis elegan 0.746 0.114 0.428 7.5e-09
WB|WBGene00010421 481 H32K16.1 [Caenorhabditis elega 0.773 0.120 0.431 2e-08
UNIPROTKB|H0YB60145 SLC36A1 "Proton-coupled amino 0.706 0.365 0.464 2.6e-08
UNIPROTKB|H0YBS289 SLC36A1 "Proton-coupled amino 0.706 0.595 0.464 2.6e-08
FB|FBgn0033760 474 CG8785 [Drosophila melanogaste 0.76 0.120 0.403 1.4e-07
FB|FBgn0032036 CG13384 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 2.0e-11, P = 2.0e-11
 Identities = 29/57 (50%), Positives = 38/57 (66%)

Query:    16 IVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPK 72
             ++ LENNM+ P D+    GV N GMV + CLY   G  GY+KYG   +GS+TLNLP+
Sbjct:   307 VLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLNLPQ 363




GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS
GO:0003333 "amino acid transmembrane transport" evidence=ISS
FB|FBgn0036116 CG7888 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036007 path "pathetic" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0035300 CG1139 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030816 CG16700 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00016628 C44B7.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00010421 H32K16.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|H0YB60 SLC36A1 "Proton-coupled amino acid transporter 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YBS2 SLC36A1 "Proton-coupled amino acid transporter 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0033760 CG8785 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
pfam01490 406 pfam01490, Aa_trans, Transmembrane amino acid tran 2e-10
>gnl|CDD|216528 pfam01490, Aa_trans, Transmembrane amino acid transporter protein Back     alignment and domain information
 Score = 54.2 bits (131), Expect = 2e-10
 Identities = 20/59 (33%), Positives = 36/59 (61%)

Query: 16  IVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKTS 74
           ++ ++N MK P+ ++    V    ++ +T LY   GLVGY+ +G   +G++ LNLPK+ 
Sbjct: 212 LLPIQNTMKSPSKFKAMTKVLLTAIIIVTVLYILVGLVGYLAFGNNVKGNILLNLPKSD 270


This transmembrane region is found in many amino acid transporters including UNC-47 and MTR. UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT). UNC-47 is predicted to have 10 transmembrane domains. MTR is a N system amino acid transporter system protein involved in methyltryptophan resistance. Other members of this family include proline transporters and amino acid permeases. Length = 406

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 75
KOG1304|consensus 449 99.89
PF01490 409 Aa_trans: Transmembrane amino acid transporter pro 99.5
PLN03074 473 auxin influx permease; Provisional 99.49
KOG1303|consensus 437 99.49
PTZ00206 467 amino acid transporter; Provisional 99.48
KOG1305|consensus 411 99.05
KOG4303|consensus 524 98.92
COG0814 415 SdaC Amino acid permeases [Amino acid transport an 98.49
TIGR00837 381 araaP aromatic amino acid transport protein. aroma 90.05
PRK11021 410 putative transporter; Provisional 88.1
TIGR00912 359 2A0309 spore germination protein (amino acid perme 86.71
TIGR00906 557 2A0303 cationic amino acid transport permease. 86.18
PRK10655 438 potE putrescine transporter; Provisional 84.72
PRK10435 435 cadB lysine/cadaverine antiporter; Provisional 83.87
KOG1287|consensus 479 83.71
TIGR00909 429 2A0306 amino acid transporter. 81.69
COG0531 466 PotE Amino acid transporters [Amino acid transport 81.5
PRK11357 445 frlA putative fructoselysine transporter; Provisio 81.46
TIGR00911 501 2A0308 L-type amino acid transporter. 80.63
>KOG1304|consensus Back     alignment and domain information
Probab=99.89  E-value=5.6e-24  Score=155.65  Aligned_cols=72  Identities=39%  Similarity=0.685  Sum_probs=69.0

Q ss_pred             hhhhhcccccceeeehhhHHhCCCCCCCCCccchhhhHHHHHHHHHHHHHhhhHhhccccccchhhhcCCCC
Q psy16922          2 FAQIEKNENLLTSKIVSLENNMKQPADYRKPCGVFNIGMVFITCLYGFTGLVGYMKYGAATQGSVTLNLPKT   73 (75)
Q Consensus         2 ~~~~~~~~~~g~~vv~~i~~~Mk~p~~f~~~~~vl~~s~~i~~~ly~~~G~~GYl~fG~~v~~~I~lnlp~~   73 (75)
                      |.-.++|++||+|+++|+||+||+|++|+.++++++.+|.+++++|..+|++||++|||+++++||+|+|++
T Consensus       246 f~GtaifafEGig~VLPlEn~Mk~P~~F~g~~gVLn~~M~~V~~ly~~~Gf~GYl~fG~~v~~sITLNLP~~  317 (449)
T KOG1304|consen  246 FFGTAIFAFEGIGMVLPLENSMKKPQKFPGPFGVLNLGMGIVTLLYIFLGFFGYLAFGDDVKGSITLNLPQE  317 (449)
T ss_pred             HHHHHHHHhccceEEEehhhcccChhhcCCccchHHHHHHHHHHHHHHHHHHHHhhccccccceEEecCCcc
Confidence            455789999999999999999999999999999999999999999999999999999999999999999993



>PF01490 Aa_trans: Transmembrane amino acid transporter protein; InterPro: IPR013057 This transmembrane region is found in many amino acid transporters including P34579 from SWISSPROT (UNC-47) and P40501 from SWISSPROT (MTR) Back     alignment and domain information
>PLN03074 auxin influx permease; Provisional Back     alignment and domain information
>KOG1303|consensus Back     alignment and domain information
>PTZ00206 amino acid transporter; Provisional Back     alignment and domain information
>KOG1305|consensus Back     alignment and domain information
>KOG4303|consensus Back     alignment and domain information
>COG0814 SdaC Amino acid permeases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00837 araaP aromatic amino acid transport protein Back     alignment and domain information
>PRK11021 putative transporter; Provisional Back     alignment and domain information
>TIGR00912 2A0309 spore germination protein (amino acid permease) Back     alignment and domain information
>TIGR00906 2A0303 cationic amino acid transport permease Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>KOG1287|consensus Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>TIGR00911 2A0308 L-type amino acid transporter Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 90.09
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 90.08
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 88.01
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Back     alignment and structure
Probab=90.09  E-value=0.11  Score=36.48  Aligned_cols=52  Identities=21%  Similarity=0.142  Sum_probs=41.2

Q ss_pred             hcccccceeeehhhHHhCCCCCC-CCCccchhhhHHHHHHHHHHHHHhhhHhhccc
Q psy16922          6 EKNENLLTSKIVSLENNMKQPAD-YRKPCGVFNIGMVFITCLYGFTGLVGYMKYGA   60 (75)
Q Consensus         6 ~~~~~~g~~vv~~i~~~Mk~p~~-f~~~~~vl~~s~~i~~~ly~~~G~~GYl~fG~   60 (75)
                      ..++|.|.-.....-.|+|||++ .|   +.+..++.+++++|+...+.-....++
T Consensus       210 ~~~a~~G~e~~~~~a~E~k~P~k~ip---~ai~~~~~~~~~~y~~~~~~~~~~~~~  262 (511)
T 4djk_A          210 FILSYMGVEASATHVNEMSNPGRDYP---LAMLLLMVAAICLSSVGGLSIAMVIPG  262 (511)
T ss_dssp             HHHHHTTGGGGTGGGSSSSCCTTTHH---HHHHHHHHHHHHHHHHHHHHHHTTSCT
T ss_pred             HHHHHhhHHHHHHHHHhccCcccchh---HHHHHHHHHHHHHHHHHHHHHHeecCH
Confidence            45778888889999999999964 45   489999999999999887755555554



>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00