Diaphorina citri psyllid: psy16924


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGISHQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
cccHHHHHHHHccccccccccccccEEEEccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEcc
**********CKDPNPIIDGRKANVNLAILGAK************RSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGISHQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding protein 24 Plays a role in myogenic differentiation by regulating MYOG levels. Binds to the 3'-UTR of MYOG mRNA and regulates its stability.confidentQ9BX46
RNA-binding protein 24 Plays a role in myogenic differentiation by regulating MYOG levels. Binds to the 3'-UTR of MYOG mRNA and regulates its stability.confidentD3Z4I3
RNA-binding protein 24 Plays a role in myogenic differentiation by regulating myog levels. May bind to the 3'-UTR of myog mRNA and regulate its stability.confidentQ6P8A7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070935 [BP]3'-UTR-mediated mRNA stabilizationprobableGO:0019222, GO:0043489, GO:0043488, GO:0043487, GO:0010608, GO:0050789, GO:0060255, GO:0065007, GO:0048255, GO:0008150, GO:0065008, GO:0010468
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0043484 [BP]regulation of RNA splicingprobableGO:0080090, GO:0019222, GO:0060255, GO:0051252, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0006977 [BP]DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrestprobableGO:0051726, GO:0044699, GO:0010948, GO:0044773, GO:0044774, GO:0007165, GO:0035556, GO:0072331, GO:0050789, GO:0072401, GO:0090068, GO:0051716, GO:2000134, GO:0031570, GO:0031571, GO:0072395, GO:0010564, GO:0071158, GO:0065007, GO:1901988, GO:0048518, GO:0048519, GO:0071156, GO:1901990, GO:0030330, GO:0008150, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0044763, GO:0023052, GO:0007154, GO:0072413, GO:0042770, GO:0044700, GO:0007049, GO:0000077, GO:2000045, GO:0000075, GO:0072431, GO:0022402, GO:0072422, GO:0033554, GO:1901991, GO:0044783, GO:0007093, GO:0050896, GO:0048523, GO:0048522
GO:0010830 [BP]regulation of myotube differentiationprobableGO:1901861, GO:0016202, GO:0051239, GO:0050793, GO:0048742, GO:0048634, GO:0060284, GO:0050794, GO:0008150, GO:0051153, GO:0045595, GO:0065007, GO:2000026, GO:0051147, GO:2001014, GO:0048641, GO:0050789
GO:0006978 [BP]DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediatorprobableGO:0044700, GO:0051716, GO:0030330, GO:0042772, GO:0050896, GO:0009987, GO:0008150, GO:0044699, GO:0050794, GO:0006974, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0072331, GO:0050789, GO:0042770
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003229 [BP]ventricular cardiac muscle tissue developmentprobableGO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0072359, GO:0009888, GO:0048738, GO:0014706, GO:0072358, GO:0044767, GO:0008150, GO:0060537, GO:0048731, GO:0007275, GO:0044699
GO:0003228 [BP]atrial cardiac muscle tissue developmentprobableGO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0072359, GO:0009888, GO:0048738, GO:0014706, GO:0072358, GO:0044767, GO:0008150, GO:0060537, GO:0048731, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0001947 [BP]heart loopingprobableGO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CQD, chain A
Confidence level:confident
Coverage over the Query: 2-43
View the alignment between query and template
View the model in PyMOL