Psyllid ID: psy16924


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGISHQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
cccHHHHHHHHccccccccccccccEEEEccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEcc
cccHHHHHHHHccccccEccccccEEHHHHcccccccccccccccccccccccccccccccccEEEEEEcccEEEccccccccccEEEEEEEEc
mgdrpaaerackdpnpiidgrkANVNLAIlgakprgtlppgishqrslalgsndfeytgwPSFLMIYVHMGSiltfefnpflkpypisgikllv
mgdrpaaerackdpnpiidgrkANVNLAILGakprgtlppgISHQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEfnpflkpypisgikllv
MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGISHQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
*********************KANVNLAILGAK************RSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKL**
**********CKDPNPIIDGRKANVNLAILG****************************WPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
*********ACKDPNPIIDGRKANVNLAILGAKPRGTLPPGISHQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
********RACKDPNPIIDGRKANVNLAILGAKPR**LPPGI*HQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGISHQRSLALGSNDFEYTGWPSFLMIYVHMGSILTFEFNPFLKPYPISGIKLLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
Q9I8B3224 RNA-binding protein 24-B N/A N/A 0.446 0.187 0.790 1e-12
Q5ZJX4215 RNA-binding protein 38 OS yes N/A 0.372 0.162 0.914 2e-12
Q6P8A7226 RNA-binding protein 24 OS yes N/A 0.446 0.185 0.790 2e-12
D3Z4I3236 RNA-binding protein 24 OS yes N/A 0.446 0.177 0.790 2e-12
Q9BX46236 RNA-binding protein 24 OS yes N/A 0.446 0.177 0.790 2e-12
Q7T3I7214 RNA-binding protein 38 OS N/A N/A 0.372 0.163 0.914 2e-12
Q6DIV4219 RNA-binding protein 38 OS no N/A 0.372 0.159 0.914 2e-12
Q6GQD3225 RNA-binding protein 24-A N/A N/A 0.446 0.186 0.790 2e-12
Q5ZMA3225 RNA-binding protein 24 OS yes N/A 0.446 0.186 0.790 2e-12
Q9H0Z9239 RNA-binding protein 38 OS no N/A 0.542 0.213 0.637 3e-12
>sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (83%), Gaps = 1/43 (2%)

Query: 1   MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGIS 43
           M DR AAERACKDPNPIIDGRKANVNLA LGAKPR  + PG +
Sbjct: 59  MADRAAAERACKDPNPIIDGRKANVNLAYLGAKPR-IMQPGFA 100




Plays a role in myogenic differentiation by regulating myog levels. May bind to the 3'-UTR of myog mRNA and regulate its stability.
Xenopus laevis (taxid: 8355)
>sp|Q5ZJX4|RBM38_CHICK RNA-binding protein 38 OS=Gallus gallus GN=RBM38 PE=2 SV=1 Back     alignment and function description
>sp|Q6P8A7|RBM24_XENTR RNA-binding protein 24 OS=Xenopus tropicalis GN=rbm24 PE=2 SV=1 Back     alignment and function description
>sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 Back     alignment and function description
>sp|Q9BX46|RBM24_HUMAN RNA-binding protein 24 OS=Homo sapiens GN=RBM24 PE=1 SV=1 Back     alignment and function description
>sp|Q7T3I7|RBM38_XENLA RNA-binding protein 38 OS=Xenopus laevis GN=rbm38 PE=1 SV=2 Back     alignment and function description
>sp|Q6DIV4|RBM38_XENTR RNA-binding protein 38 OS=Xenopus tropicalis GN=rbm38 PE=2 SV=1 Back     alignment and function description
>sp|Q6GQD3|RB24A_XENLA RNA-binding protein 24-A OS=Xenopus laevis GN=rbm24-a PE=2 SV=1 Back     alignment and function description
>sp|Q5ZMA3|RBM24_CHICK RNA-binding protein 24 OS=Gallus gallus GN=RBM24 PE=2 SV=2 Back     alignment and function description
>sp|Q9H0Z9|RBM38_HUMAN RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
328718182 292 PREDICTED: RNA-binding protein 38-like [ 0.457 0.147 0.860 3e-14
332026355 248 RNA-binding protein 38 [Acromyrmex echin 0.606 0.229 0.647 7e-14
383852443 279 PREDICTED: RNA-binding protein 38-like i 0.404 0.136 0.973 9e-14
328786606 280 PREDICTED: RNA-binding protein 38-like i 0.404 0.135 0.973 9e-14
345485059 271 PREDICTED: RNA-binding protein 38-like i 0.404 0.140 0.947 2e-13
307198651 225 RNA-binding protein 24-B [Harpegnathos s 0.404 0.168 0.947 2e-13
322794836135 hypothetical protein SINV_12982 [Solenop 0.404 0.281 0.973 3e-13
345485061 327 PREDICTED: RNA-binding protein 38-like i 0.404 0.116 0.947 3e-13
380017616 333 PREDICTED: RNA-binding protein 38-like [ 0.404 0.114 0.973 5e-13
357605924 261 RNA binding region containing protein 1 0.404 0.145 0.947 7e-13
>gi|328718182|ref|XP_001948033.2| PREDICTED: RNA-binding protein 38-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (90%)

Query: 1   MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGIS 43
           MGDRPAAERACK+PNPIIDGRKANVNLAILGAKPRG L P  +
Sbjct: 97  MGDRPAAERACKEPNPIIDGRKANVNLAILGAKPRGNLQPAFA 139




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332026355|gb|EGI66484.1| RNA-binding protein 38 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383852443|ref|XP_003701737.1| PREDICTED: RNA-binding protein 38-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328786606|ref|XP_003250820.1| PREDICTED: RNA-binding protein 38-like isoform 1 [Apis mellifera] gi|340719620|ref|XP_003398247.1| PREDICTED: RNA-binding protein 38-like [Bombus terrestris] gi|350410698|ref|XP_003489112.1| PREDICTED: RNA-binding protein 38-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345485059|ref|XP_001606177.2| PREDICTED: RNA-binding protein 38-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307198651|gb|EFN79487.1| RNA-binding protein 24-B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322794836|gb|EFZ17783.1| hypothetical protein SINV_12982 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345485061|ref|XP_003425186.1| PREDICTED: RNA-binding protein 38-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380017616|ref|XP_003692748.1| PREDICTED: RNA-binding protein 38-like [Apis florea] Back     alignment and taxonomy information
>gi|357605924|gb|EHJ64837.1| RNA binding region containing protein 1 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
ZFIN|ZDB-GENE-060312-43245 rbm24b "RNA binding motif prot 0.446 0.171 0.837 2.1e-13
UNIPROTKB|E1BZ17245 RBM24 "RNA-binding protein 24" 0.446 0.171 0.790 7.1e-13
UNIPROTKB|Q5ZMA3225 RBM24 "RNA-binding protein 24" 0.446 0.186 0.790 7.1e-13
UNIPROTKB|A6QPJ1236 RBM24 "Uncharacterized protein 0.446 0.177 0.790 7.1e-13
UNIPROTKB|E2RM01116 RBM24 "Uncharacterized protein 0.446 0.362 0.790 7.1e-13
UNIPROTKB|E9PAY4178 RBM24 "RNA-binding protein 24" 0.446 0.235 0.790 7.1e-13
UNIPROTKB|H0YA6180 RBM24 "RNA-binding protein 24" 0.446 0.525 0.790 7.1e-13
UNIPROTKB|Q9BX46236 RBM24 "RNA-binding protein 24" 0.446 0.177 0.790 7.1e-13
UNIPROTKB|F1RUJ2254 RBM24 "Uncharacterized protein 0.446 0.165 0.790 7.1e-13
UNIPROTKB|Q6GQD3225 rbm24-a "RNA-binding protein 2 0.446 0.186 0.790 7.1e-13
ZFIN|ZDB-GENE-060312-43 rbm24b "RNA binding motif protein 24b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 2.1e-13, P = 2.1e-13
 Identities = 36/43 (83%), Positives = 36/43 (83%)

Query:     1 MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGIS 43
             M DR AAERACKDPNPIIDGRKANVNLA LGAKPR  L PG S
Sbjct:    59 MADRSAAERACKDPNPIIDGRKANVNLAYLGAKPR-ILQPGFS 100




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0001947 "heart looping" evidence=IMP
GO:0072358 "cardiovascular system development" evidence=IGI
GO:0003228 "atrial cardiac muscle tissue development" evidence=IMP
GO:0003229 "ventricular cardiac muscle tissue development" evidence=IMP
UNIPROTKB|E1BZ17 RBM24 "RNA-binding protein 24" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMA3 RBM24 "RNA-binding protein 24" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QPJ1 RBM24 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM01 RBM24 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PAY4 RBM24 "RNA-binding protein 24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YA61 RBM24 "RNA-binding protein 24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BX46 RBM24 "RNA-binding protein 24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUJ2 RBM24 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GQD3 rbm24-a "RNA-binding protein 24-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9BX46RBM24_HUMANNo assigned EC number0.79060.44680.1779yesN/A
D3Z4I3RBM24_MOUSENo assigned EC number0.79060.44680.1779yesN/A
Q5ZMA3RBM24_CHICKNo assigned EC number0.79060.44680.1866yesN/A
Q6P8A7RBM24_XENTRNo assigned EC number0.79060.44680.1858yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 8e-13
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
 Score = 57.6 bits (140), Expect = 8e-13
 Identities = 23/28 (82%), Positives = 25/28 (89%)

Query: 1  MGDRPAAERACKDPNPIIDGRKANVNLA 28
            D+ +AERACKDPNPIIDGRKANVNLA
Sbjct: 49 FKDKESAERACKDPNPIIDGRKANVNLA 76


This subfamily corresponds to the RRM of RBM24 and RBM38 from vertebrate, SUPpressor family member SUP-12 from Caenorhabditis elegans and similar proteins. Both, RBM24 and RBM38, are preferentially expressed in cardiac and skeletal muscle tissues. They regulate myogenic differentiation by controlling the cell cycle in a p21-dependent or -independent manner. RBM24, also termed RNA-binding region-containing protein 6, interacts with the 3'-untranslated region (UTR) of myogenin mRNA and regulates its stability in C2C12 cells. RBM38, also termed CLL-associated antigen KW-5, or HSRNASEB, or RNA-binding region-containing protein 1(RNPC1), or ssDNA-binding protein SEB4, is a direct target of the p53 family. It is required for maintaining the stability of the basal and stress-induced p21 mRNA by binding to their 3'-UTRs. It also binds the AU-/U-rich elements in p63 3'-UTR and regulates p63 mRNA stability and activity. SUP-12 is a novel tissue-specific splicing factor that controls muscle-specific splicing of the ADF/cofilin pre-mRNA in C. elegans. All family members contain a conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). . Length = 76

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
KOG0149|consensus247 99.82
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 80.83
>KOG0149|consensus Back     alignment and domain information
Probab=99.82  E-value=4.1e-21  Score=150.80  Aligned_cols=36  Identities=75%  Similarity=1.121  Sum_probs=34.6

Q ss_pred             CCCHHHHHHHhcCCCCcccccccceeeeecCCccCC
Q psy16924          1 MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRG   36 (94)
Q Consensus         1 m~D~eaA~rAc~dpnPiIDGRrANcNLA~LGakPr~   36 (94)
                      |+|+|||+|||+||||||||||||||||+||+|||.
T Consensus        61 f~d~~aa~rAc~dp~piIdGR~aNcnlA~lg~~pR~   96 (247)
T KOG0149|consen   61 FRDAEAATRACKDPNPIIDGRKANCNLASLGGKPRP   96 (247)
T ss_pred             eecHHHHHHHhcCCCCcccccccccchhhhcCccCC
Confidence            689999999999999999999999999999999984



>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 3e-13
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure

Iteration: 1

Score = 70.1 bits (170), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 32/35 (91%), Positives = 32/35 (91%) Query: 1 MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPR 35 M DR AAERACKDPNPIIDGRKANVNLA LGAKPR Sbjct: 66 MADRAAAERACKDPNPIIDGRKANVNLAYLGAKPR 100

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
2cqd_A116 RNA-binding region containing protein 1; RNA recog 7e-10
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-05
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 8e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 9e-04
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
 Score = 50.8 bits (122), Expect = 7e-10
 Identities = 32/41 (78%), Positives = 32/41 (78%)

Query: 1   MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPG 41
           M DR AAERACKDPNPIIDGRKANVNLA LGAKPR      
Sbjct: 66  MADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGF 106


>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
2cqd_A116 RNA-binding region containing protein 1; RNA recog 94.61
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 92.85
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 91.94
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 90.19
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 85.6
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 85.13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 84.12
2div_A99 TRNA selenocysteine associated protein; structural 83.95
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 83.07
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 82.77
2dis_A109 Unnamed protein product; structural genomics, RRM 82.37
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 82.15
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 81.84
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 81.67
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 81.48
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 81.39
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 81.14
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 80.82
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 80.63
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 80.45
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
Probab=94.61  E-value=0.044  Score=33.95  Aligned_cols=41  Identities=80%  Similarity=1.242  Sum_probs=33.7

Q ss_pred             CCHHHHHHHhcCCCCcccccccceeeeecCCccCCCCCCCCc
Q psy16924          2 GDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGIS   43 (94)
Q Consensus         2 ~D~eaA~rAc~dpnPiIDGRrANcNLA~LGakPr~~~~~gf~   43 (94)
                      .+.++|++|++.-|-.|+||+-.|.+|.-..+|+ ..++++.
T Consensus        67 ~~~~~a~~Ai~~~~~~~~g~~l~V~~a~~~~~~~-~~~~~~~  107 (116)
T 2cqd_A           67 ADRAAAERACKDPNPIIDGRKANVNLAYLGAKPR-SLQTGFA  107 (116)
T ss_dssp             SSHHHHHHHHTCSSCEETTEECEEEESTTTCCCC-CCCCCCS
T ss_pred             CCHHHHHHHHHhCCCcCCCEEEEEEEcccCCCcc-ccCCCcc
Confidence            5789999999977779999999999999888887 3444443



>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 94
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 8e-07
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding region containing protein 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.3 bits (96), Expect = 8e-07
 Identities = 34/43 (79%), Positives = 36/43 (83%), Gaps = 1/43 (2%)

Query: 1   MGDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGIS 43
           M DR AAERACKDPNPIIDGRKANVNLA LGAKPR +L  G +
Sbjct: 59  MADRAAAERACKDPNPIIDGRKANVNLAYLGAKPR-SLQTGFA 100


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 97.7
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 95.42
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 94.45
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 93.53
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 92.99
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 92.82
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 92.49
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 92.06
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 89.67
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 88.2
d2cpja186 Non-POU domain-containing octamer-binding protein, 87.27
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 86.52
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 85.87
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 85.44
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 83.5
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 82.88
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 82.53
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 82.45
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 82.11
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 81.55
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 81.52
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 81.14
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 81.0
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 80.82
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 80.12
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding region containing protein 1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.70  E-value=1.3e-05  Score=49.65  Aligned_cols=42  Identities=79%  Similarity=1.195  Sum_probs=37.9

Q ss_pred             CCHHHHHHHhcCCCCcccccccceeeeecCCccCCCCCCCCcc
Q psy16924          2 GDRPAAERACKDPNPIIDGRKANVNLAILGAKPRGTLPPGISH   44 (94)
Q Consensus         2 ~D~eaA~rAc~dpnPiIDGRrANcNLA~LGakPr~~~~~gf~~   44 (94)
                      .+.|+|++|++..|..|+||+-.|++|.-..+|| ..++||++
T Consensus        60 ~~~~~A~~Ai~~~~~~l~Gr~l~V~~a~~~~~pr-~~~~g~~~  101 (103)
T d2cqda1          60 ADRAAAERACKDPNPIIDGRKANVNLAYLGAKPR-SLQTGFAI  101 (103)
T ss_dssp             SSHHHHHHHHTCSSCEETTEECEEEESTTTCCCC-CCCCCCSC
T ss_pred             CCHHHHHHHHHHCCCcCCCEEEEEEEcCCCCCCC-CCCCCCCC
Confidence            5789999999988889999999999999999998 57888765



>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure