Diaphorina citri psyllid: psy16934


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MSLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLAI
ccccEEEcccccEEEcEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccc
***QLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0047498 [MF]calcium-dependent phospholipase A2 activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004623, GO:0004620, GO:0016298
GO:0006644 [BP]phospholipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255
GO:0009405 [BP]pathogenesisprobableGO:0008150, GO:0051704
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1POC, chain A
Confidence level:very confident
Coverage over the Query: 17-82
View the alignment between query and template
View the model in PyMOL