Psyllid ID: psy16934


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MSLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLAI
ccccEEEcccccEEEcEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccc
ccEEEEEEccccEEEEEccccccEcccccccccHHHccccccHHHHHHHccccccccccccccccccccccccccccEEEEEcccccEEEEEHccc
MSLQLYQVGYKNYLLDFKSIRtkwcgtgdiardisdtgifhdidsccrdhdlcpenivakstkynltndgsfTRRLRKFYWekqggeqltltslai
MSLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENivakstkynltndgsftRRLRKFywekqggeqltltslai
MSLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLAI
***QLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQ************
*******VGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLA*
MSLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLAI
*SLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLQLYQVGYKNYLLDFKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEKQGGEQLTLTSLAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
P0C8L9239 Phospholipase A2 OS=Hadru N/A N/A 0.531 0.213 0.538 2e-10
P59888167 Phospholipase A2 imperato N/A N/A 0.531 0.305 0.557 2e-10
Q7M4I6136 Phospholipase A2 OS=Megab N/A N/A 0.552 0.389 0.452 4e-09
P82971136 Phospholipase A2 OS=Bombu no N/A 0.552 0.389 0.452 3e-08
Q7M4I5134 Phospholipase A2 OS=Apis N/A N/A 0.552 0.395 0.452 5e-08
Q9NZ20 509 Group 3 secretory phospho yes N/A 0.489 0.092 0.468 7e-08
Q9BMK4134 Phospholipase A2 OS=Apis N/A N/A 0.552 0.395 0.433 1e-07
Q1JPB9 501 Group 3 secretory phospho yes N/A 0.489 0.093 0.446 2e-07
Q6PXP0157 Phospholipase A2 phaiodac N/A N/A 0.520 0.318 0.538 2e-07
P00630167 Phospholipase A2 OS=Apis no N/A 0.552 0.317 0.433 4e-07
>sp|P0C8L9|PA2_HADGE Phospholipase A2 OS=Hadrurus gertschi PE=2 SV=1 Back     alignment and function desciption
 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 38/52 (73%), Gaps = 1/52 (1%)

Query: 22  TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFT 73
           TKWCG G+ A + SD G F+++D CCR+HD C +NI A  TKY L N+G++T
Sbjct: 111 TKWCGAGNEAANYSDLGYFNNVDRCCREHDHC-DNIPAGETKYGLKNEGTYT 161




Phosholipase toxin, which may catalyze the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Inhibits both skeletal (RYR1) and cardiac (RYR2) ryanodine receptors (calcium release channels). Probably blocks ryanodine receptors by generating a lipid product.
Hadrurus gertschi (taxid: 380989)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 4
>sp|P59888|IPTXI_PANIM Phospholipase A2 imperatoxin-1 OS=Pandinus imperator PE=1 SV=1 Back     alignment and function description
>sp|Q7M4I6|PA2_MEGPE Phospholipase A2 OS=Megabombus pennsylvanicus PE=1 SV=1 Back     alignment and function description
>sp|P82971|PA2_BOMTE Phospholipase A2 OS=Bombus terrestris PE=1 SV=1 Back     alignment and function description
>sp|Q7M4I5|PA2_APIDO Phospholipase A2 OS=Apis dorsata PE=1 SV=1 Back     alignment and function description
>sp|Q9NZ20|PA2G3_HUMAN Group 3 secretory phospholipase A2 OS=Homo sapiens GN=PLA2G3 PE=1 SV=2 Back     alignment and function description
>sp|Q9BMK4|PA2_APICC Phospholipase A2 OS=Apis cerana cerana PE=2 SV=1 Back     alignment and function description
>sp|Q1JPB9|PA2G3_BOVIN Group 3 secretory phospholipase A2 OS=Bos taurus GN=PLA2G3 PE=2 SV=1 Back     alignment and function description
>sp|Q6PXP0|PA2_ANUPH Phospholipase A2 phaiodactylipin OS=Anuroctonus phaiodactylus PE=1 SV=2 Back     alignment and function description
>sp|P00630|PA2_APIME Phospholipase A2 OS=Apis mellifera PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
357627276 710 hypothetical protein KGM_00059 [Danaus p 0.552 0.074 0.566 1e-11
405958940 591 Phospholipid scramblase 2 [Crassostrea g 0.593 0.096 0.561 2e-11
225543695 214 phospholipase A2C [Tribolium castaneum] 0.614 0.275 0.539 3e-11
225543486173 phospholipase A2A [Tribolium castaneum] 0.687 0.381 0.514 3e-11
332029748 259 Phospholipase A2 isozyme PA3A/PA3B/PA5 [ 0.552 0.204 0.584 4e-11
225543488 261 phospholipase A2B precursor [Tribolium c 0.552 0.203 0.566 1e-10
322798603 264 hypothetical protein SINV_04203 [Solenop 0.552 0.200 0.566 1e-10
350406620 266 PREDICTED: group 3 secretory phospholipa 0.552 0.199 0.584 2e-10
340721396 266 PREDICTED: group 3 secretory phospholipa 0.552 0.199 0.584 2e-10
195133372 312 GI16365 [Drosophila mojavensis] gi|19390 0.552 0.169 0.566 4e-10
>gi|357627276|gb|EHJ77013.1| hypothetical protein KGM_00059 [Danaus plexippus] Back     alignment and taxonomy information
 Score = 73.6 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/53 (56%), Positives = 37/53 (69%)

Query: 22  TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTR 74
           TKWCGTGDIA D  D G    +D CCR HDLCP  + A ST+YNLTN+  +++
Sbjct: 605 TKWCGTGDIAADYHDLGSDRPLDRCCRTHDLCPSKVRAFSTRYNLTNNSLYSK 657




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|405958940|gb|EKC25020.1| Phospholipid scramblase 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|225543695|ref|NP_001139461.1| phospholipase A2C [Tribolium castaneum] gi|224383701|gb|ACN42749.1| phospholipase A2C [Tribolium castaneum] gi|270006982|gb|EFA03430.1| hypothetical protein TcasGA2_TC013419 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|225543486|ref|NP_001139389.1| phospholipase A2A [Tribolium castaneum] gi|224383697|gb|ACN42747.1| phospholipase A2 [Tribolium castaneum] gi|270003337|gb|EEZ99784.1| hypothetical protein TcasGA2_TC002563 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332029748|gb|EGI69617.1| Phospholipase A2 isozyme PA3A/PA3B/PA5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|225543488|ref|NP_001139390.1| phospholipase A2B precursor [Tribolium castaneum] gi|224383699|gb|ACN42748.1| phospholipase A2B [Tribolium castaneum] gi|270011520|gb|EFA07968.1| hypothetical protein TcasGA2_TC005550 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322798603|gb|EFZ20207.1| hypothetical protein SINV_04203 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350406620|ref|XP_003487830.1| PREDICTED: group 3 secretory phospholipase A2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721396|ref|XP_003399107.1| PREDICTED: group 3 secretory phospholipase A2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195133372|ref|XP_002011113.1| GI16365 [Drosophila mojavensis] gi|193907088|gb|EDW05955.1| GI16365 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
FB|FBgn0250862363 CG42237 [Drosophila melanogast 0.552 0.146 0.566 1.7e-11
UNIPROTKB|Q6PXP0157 Q6PXP0 "Phospholipase A2 phaio 0.520 0.318 0.538 2.5e-10
FB|FBgn0050503173 CG30503 [Drosophila melanogast 0.531 0.294 0.470 1.8e-09
UNIPROTKB|P00630167 P00630 "Phospholipase A2" [Api 0.552 0.317 0.433 9.7e-09
FB|FBgn0029720 364 CG3009 [Drosophila melanogaste 0.552 0.145 0.433 6.9e-08
UNIPROTKB|Q9NZ20 509 PLA2G3 "Group 3 secretory phos 0.489 0.092 0.468 7.5e-08
UNIPROTKB|Q1JPB9 501 PLA2G3 "Group 3 secretory phos 0.489 0.093 0.446 2e-07
UNIPROTKB|F1RPC3 501 PLA2G3 "Uncharacterized protei 0.489 0.093 0.446 2e-07
UNIPROTKB|F1Q3B4 512 PLA2G3 "Uncharacterized protei 0.489 0.091 0.446 2.6e-07
ZFIN|ZDB-GENE-051113-96 528 zgc:123275 "zgc:123275" [Danio 0.541 0.098 0.403 1.2e-06
FB|FBgn0250862 CG42237 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 163 (62.4 bits), Expect = 1.7e-11, P = 1.7e-11
 Identities = 30/53 (56%), Positives = 33/53 (62%)

Query:    22 TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTR 74
             TKWCGTGDIA   SD G    +D CCR HDLCP  I A   KY L ND  +T+
Sbjct:   258 TKWCGTGDIAETYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYELMNDSLYTK 310




GO:0005509 "calcium ion binding" evidence=IEA
GO:0016042 "lipid catabolic process" evidence=IEA
GO:0006644 "phospholipid metabolic process" evidence=IEA
GO:0004623 "phospholipase A2 activity" evidence=IEA
UNIPROTKB|Q6PXP0 Q6PXP0 "Phospholipase A2 phaiodactylipin" [Anuroctonus phaiodactylus (taxid:246982)] Back     alignment and assigned GO terms
FB|FBgn0050503 CG30503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P00630 P00630 "Phospholipase A2" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
FB|FBgn0029720 CG3009 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZ20 PLA2G3 "Group 3 secretory phospholipase A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JPB9 PLA2G3 "Group 3 secretory phospholipase A2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPC3 PLA2G3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3B4 PLA2G3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-96 zgc:123275 "zgc:123275" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691
3rd Layer3.1.1.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
cd0470497 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: 2e-22
pfam0582699 pfam05826, Phospholip_A2_2, Phospholipase A2 8e-21
cd12122132 cd12122, AMPKA_C, C-terminal regulatory domain of 2e-06
cd0061883 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a 4e-06
cd1219996 cd12199, AMPKA1_C, C-terminal regulatory domain of 6e-04
>gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information
 Score = 82.7 bits (205), Expect = 2e-22
 Identities = 30/53 (56%), Positives = 35/53 (66%)

Query: 22 TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTR 74
          TKWCG G+IA + SD G F + D CCR+HD CP+ I A   KY LTN   FTR
Sbjct: 6  TKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGLTNTRLFTR 58


PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s. Length = 97

>gnl|CDD|147789 pfam05826, Phospholip_A2_2, Phospholipase A2 Back     alignment and domain information
>gnl|CDD|213378 cd12122, AMPKA_C, C-terminal regulatory domain of 5'-AMP-activated protein kinase (AMPK) alpha catalytic subunit Back     alignment and domain information
>gnl|CDD|153092 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>gnl|CDD|213384 cd12199, AMPKA1_C, C-terminal regulatory domain of 5'-AMP-activated protein kinase (AMPK) alpha 1 catalytic subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
PF0582699 Phospholip_A2_2: Phospholipase A2; InterPro: IPR00 100.0
cd0470497 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-fam 100.0
cd04705100 PLA2_group_III_like PLA2_group_III_like: A sub-fam 99.83
cd0061883 PLA2_like PLA2_like: Phospholipase A2, a super-fam 99.68
smart00085117 PA2c Phospholipase A2. 99.12
cd04706117 PLA2_plant PLA2_plant: Plant-specific sub-family o 98.29
cd00125115 PLA2c PLA2c: Phospholipase A2, a family of secreto 96.94
cd04707117 otoconin_90 otoconin_90: Phospholipase A2-like dom 96.88
PF0839864 Parvo_coat_N: Parvovirus coat protein VP1; InterPr 96.31
KOG4087|consensus144 95.85
PF00068116 Phospholip_A2_1: Phospholipase A2; InterPro: IPR00 92.07
>PF05826 Phospholip_A2_2: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 Back     alignment and domain information
Probab=100.00  E-value=1e-37  Score=212.60  Aligned_cols=66  Identities=42%  Similarity=0.761  Sum_probs=50.5

Q ss_pred             eecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCccccCCCcccccccccccc
Q psy16934         18 KSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEK   83 (96)
Q Consensus        18 i~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~ek   83 (96)
                      |+|||||||+||+|.+|+|||.+.+||+|||+||+||++|+|+++||||+|.++||+|||+|+.++
T Consensus         1 i~pGT~WCG~gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~~hC~Cd~~f   66 (99)
T PF05826_consen    1 IYPGTKWCGPGNIAKNYSDLGEFKETDRCCREHDHCPDKIPPGETKYGLHNPRPFTISHCDCDSRF   66 (99)
T ss_dssp             B-TT-SSSBSS---SSTT---SSHHHHHHHHHHHT-SSEE-TT-EETTEE--SSS-EEBHHHHHHH
T ss_pred             CCCCCcccCCCCCccCcccccccHHHHHHHHhhccCCCccCCCccccccccCCcCceeecCcccHH
Confidence            799999999999999999999999999999999999999999999999999999999999998873



1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation. The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.

>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 Back     alignment and domain information
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>smart00085 PA2c Phospholipase A2 Back     alignment and domain information
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia Back     alignment and domain information
>PF08398 Parvo_coat_N: Parvovirus coat protein VP1; InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>KOG4087|consensus Back     alignment and domain information
>PF00068 Phospholip_A2_1: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1poc_A134 Crystal Structure Of Bee-venom Phospholipase A2 In 4e-08
>pdb|1POC|A Chain A, Crystal Structure Of Bee-venom Phospholipase A2 In A Complex With A Transition-state Analogue Length = 134 Back     alignment and structure

Iteration: 1

Score = 53.1 bits (126), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 33/53 (62%) Query: 22 TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTR 74 T WCG G+ + ++ G F D+CCR HD+CP+ + A +K+ LTN S TR Sbjct: 6 TLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTR 58

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 1e-19
2y8l_A173 5'-AMP-activated protein kinase catalytic subunit; 5e-06
2v8q_A157 5'-AMP-activated protein kinase catalytic subunit; 6e-06
2qrd_A137 SNF1-like protein kinase SSP2; AMPK, ADP, ATP-bind 1e-05
3t4n_A179 Carbon catabolite-derepressing protein kinase; CBS 9e-05
4eai_A106 5'-AMP-activated protein kinase catalytic subunit 2e-04
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 2e-04
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Length = 134 Back     alignment and structure
 Score = 76.2 bits (187), Expect = 1e-19
 Identities = 23/53 (43%), Positives = 33/53 (62%)

Query: 22 TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTR 74
          T WCG G+ +   ++ G F   D+CCR HD+CP+ + A  +K+ LTN  S TR
Sbjct: 6  TLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTR 58


>2y8l_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, serine/threonine-protein KI; HET: ADP AMP; 2.50A {Rattus norvegicus} PDB: 2y8q_A* 2ya3_A* Length = 173 Back     alignment and structure
>2v8q_A 5'-AMP-activated protein kinase catalytic subunit; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.129.6.2 PDB: 2v92_A* 2v9j_A* 2y94_C* Length = 157 Back     alignment and structure
>2qrd_A SNF1-like protein kinase SSP2; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} SCOP: d.129.6.2 PDB: 2ooy_A* 2qr1_A* 2qrc_A* 2oox_A* 2qre_A* Length = 137 Back     alignment and structure
>3t4n_A Carbon catabolite-derepressing protein kinase; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_A* 3te5_A* 2qlv_A Length = 179 Back     alignment and structure
>4eai_A 5'-AMP-activated protein kinase catalytic subunit linker, 5'-AMP-activated protein...; AMPK, transferase; HET: AMP; 2.29A {Rattus norvegicus} PDB: 4eaj_A* 4eak_A* 4eal_A* Length = 106 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 100.0
2wg7_A130 PLA2, putative phospholipase A2; hydrolase, secret 96.72
3jql_A119 Phospholipase A2 isoform 3; phospholipase A2, hexa 95.59
1jlt_B122 Phospholipase A2, vipoxin; heterodimer complex, hy 95.26
1bk9_A124 Phospholipase A2; hydrolase, platelet aggregation 95.08
4h0s_A137 Svpla2 homolog, basic phospholipase A2 homolog CTS 95.04
1le6_A123 Group X secretory phospholipase A2; human phosphat 94.89
1p7o_A124 Phospholipase A2, mipla4; pancreatic loop, HYDR; 2 94.74
3u8i_A124 Phospholipase A2, membrane associated; secreted ph 94.72
1gp7_A151 Phospholipase A2; snake venom, KING cobra, cardiot 94.65
1g4i_A123 Phospholipase A2; lipid degradation, hydrolase; 0. 94.64
2aoz_A121 Myotoxin II, phospholipase A2 homolog; X-RAY diffr 94.59
4e4c_A119 Phospholipase A2; hydrolase; HET: MES; 1.80A {Note 94.56
3vbz_A118 Phospholipase A2 homolog, taipoxin beta chain; pho 94.53
1m8t_A119 Phospholipase A2; twinned crystal, alpha, beta, hy 94.52
1bun_A120 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 94.46
3r0l_D122 Phospholipase A2 CB; crotoxin, presynaptic neuroto 94.42
4h0q_A121 Phospholipase A2, acid 5; alpha-helix, glycerophos 94.4
1jlt_A122 Phospholipase A2 inhibitor; heterodimer complex, h 94.36
2g58_A121 Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, d 94.33
2qhd_A122 Phospholipase A2; beta sheet, three helices, prote 94.29
3dih_A122 Phospholipase A2 homolog, ammodytin L; phospholipa 94.24
1zlb_A122 Hypotensive phospholipase A2; Asp49-PLA2, toxin, s 94.14
2h4c_B122 Phospholipase A2-II; non-inhibitor acidic PLA2, ba 94.11
1mc2_A122 Acutohaemonlysin, phospholipase A2; YS49-phospholi 94.09
1g0z_A118 Phospholipase A2; toxin; 2.18A {Bungarus caeruleus 94.08
4eag_A130 EG:132E8.2 protein; AMPK, transferase; HET: ATP TA 93.95
4hg9_A122 Basic phospholipase A2 B; alpha-helix, glycerophos 93.93
1oz6_A120 Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A { 93.85
1vip_A121 Phospholipase A2; hydrolase, anticoagulant; 2.20A 93.85
1gmz_A122 Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bot 93.81
2qrd_A137 SNF1-like protein kinase SSP2; AMPK, ADP, ATP-bind 93.79
2v8q_A157 5'-AMP-activated protein kinase catalytic subunit; 92.22
2y8l_A173 5'-AMP-activated protein kinase catalytic subunit; 92.18
4eai_A106 5'-AMP-activated protein kinase catalytic subunit 90.83
3t4n_A179 Carbon catabolite-derepressing protein kinase; CBS 90.71
3ntt_A 724 Capsid protein; gene therapy vector, cystic fibros 85.87
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Back     alignment and structure
Probab=100.00  E-value=4e-36  Score=213.64  Aligned_cols=66  Identities=35%  Similarity=0.626  Sum_probs=64.5

Q ss_pred             eeecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCccccCCCccccccccccc
Q psy16934         17 FKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWE   82 (96)
Q Consensus        17 ~i~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~e   82 (96)
                      +|+|||||||+||+|.+|+|||.+.+||+|||+||+||++|++++++|||+|.++||+|||+|+.+
T Consensus         1 ~i~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~~~gl~N~~~~t~shC~CD~~   66 (134)
T 1poc_A            1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDK   66 (134)
T ss_dssp             CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSSSCEEBHHHHHH
T ss_pred             CcCCCCcccCCCCCCCCcccccCcchHhHHHhccccCcccccCccccCCeeCCCccccccCcHHHH
Confidence            689999999999999999999999999999999999999999999999999999999999999776



>2wg7_A PLA2, putative phospholipase A2; hydrolase, secretory PLA2; 2.00A {Oryza sativa} PDB: 2wg9_A* 2wg8_B 2wg8_A Back     alignment and structure
>3jql_A Phospholipase A2 isoform 3; phospholipase A2, hexapeptide, hydrolase, calcium, disulfide bond, lipid degradation, metal-binding, secreted; 1.20A {Naja sagittifera} SCOP: a.133.1.2 PDB: 1mf4_A 3jq5_A 1ln8_A 3jti_A 3nju_A* 3osh_A* 3q4y_A 1t37_A 1zm6_A 3gci_A 1yxl_A 1oxr_A 1td7_A* 1sz8_A 1a3d_A 1a3f_A 1psh_A 2osh_A 1poa_A 1pob_A* ... Back     alignment and structure
>1jlt_B Phospholipase A2, vipoxin; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1rgb_A* 2i0u_E* 1aok_B 1oqs_B Back     alignment and structure
>1bk9_A Phospholipase A2; hydrolase, platelet aggregation inhibitor, PBPB; HET: PBP; 2.00A {Gloydius halys} SCOP: a.133.1.2 PDB: 1psj_A 1ijl_A 1pp2_R Back     alignment and structure
>4h0s_A Svpla2 homolog, basic phospholipase A2 homolog CTS-R6; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.55A {Viridovipera stejnegeri} Back     alignment and structure
>1le6_A Group X secretory phospholipase A2; human phosphatidylcholine 2-acylhydrolase GX, GX SPLA2, SPLA2-X; 1.97A {Homo sapiens} SCOP: a.133.1.2 PDB: 1le7_A Back     alignment and structure
>1p7o_A Phospholipase A2, mipla4; pancreatic loop, HYDR; 2.30A {Micropechis ikaheka} SCOP: a.133.1.2 PDB: 1pwo_A 1ozy_A Back     alignment and structure
>3u8i_A Phospholipase A2, membrane associated; secreted phospholipase A2, hydrolase; HET: OLD; 1.10A {Homo sapiens} PDB: 3u8d_A* 1ayp_A 1db4_A* 1db5_A* 1dcy_A* 1j1a_A* 1bbc_A* 1kqu_A* 1pod_A 1poe_A* 3u8b_A 1kvo_A* 3u8h_A* 1n28_B 1n29_A Back     alignment and structure
>1gp7_A Phospholipase A2; snake venom, KING cobra, cardiotoxic activity, myotoxic activity, pancreatic loop, hydrolase, lipid degradation, calcium; 2.6A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>1g4i_A Phospholipase A2; lipid degradation, hydrolase; 0.97A {Bos taurus} SCOP: a.133.1.2 PDB: 1bvm_A 1fdk_A* 1bp2_A 1mkt_A 1mkv_A* 1une_A 2bpp_A 4bp2_A 2bp2_A 1kvy_A 1bpq_A 2zp3_A 1ceh_A 3bp2_A 2zp5_A 1kvx_A 1kvw_A 2zp4_A 1irb_A 2bax_A* ... Back     alignment and structure
>2aoz_A Myotoxin II, phospholipase A2 homolog; X-RAY diffration, myotoxicity, atropoides toxin; 2.08A {Atropoides nummifer} Back     alignment and structure
>4e4c_A Phospholipase A2; hydrolase; HET: MES; 1.80A {Notechis scutatus scutatus} PDB: 1ae7_A* 2not_A Back     alignment and structure
>3vbz_A Phospholipase A2 homolog, taipoxin beta chain; phospholipase A2 fold, PLA2 fold, neurotoxin, binding; 1.76A {Oxyuranus scutellatus scutellatus} PDB: 3vc0_A Back     alignment and structure
>1m8t_A Phospholipase A2; twinned crystal, alpha, beta, hydrolase; 2.10A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>1bun_A BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: a.133.1.2 Back     alignment and structure
>3r0l_D Phospholipase A2 CB; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} SCOP: a.133.1.2 PDB: 2qog_B 2qog_A 1bjj_A 1a2a_A Back     alignment and structure
>4h0q_A Phospholipase A2, acid 5; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.60A {Viridovipera stejnegeri} PDB: 1m8r_A 1m8s_A Back     alignment and structure
>1jlt_A Phospholipase A2 inhibitor; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1vpi_A 1aok_A 1q5t_A 1oqs_A 2h4c_A Back     alignment and structure
>2g58_A Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, diars, hydrolase-hydrolase inhibitor compl; HET: PHQ; 0.98A {Daboia russellii pulchella} SCOP: a.133.1.2 PDB: 1cl5_A 1fb2_A* 1jq8_A 1jq9_A 1kpm_A* 1oxl_A* 1fv0_A* 1q7a_A 1skg_A* 1sv3_A* 1sv9_A* 1sxk_A* 1tdv_A 1tg1_A* 1tg4_A 1th6_A* 1sqz_A 1tjq_A* 1tk4_A 1tp2_A* ... Back     alignment and structure
>2qhd_A Phospholipase A2; beta sheet, three helices, protein-ligand complex, hydrolase; HET: DAO; 1.95A {Echis carinatus} PDB: 2qhe_A 3bjw_A* Back     alignment and structure
>3dih_A Phospholipase A2 homolog, ammodytin L; phospholipase A2 fold, myotoxin, secreted, toxin; 2.60A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 3ux7_A Back     alignment and structure
>1zlb_A Hypotensive phospholipase A2; Asp49-PLA2, toxin, snake venom, hydrolase; 0.97A {Bothrops jararacussu} SCOP: a.133.1.2 PDB: 1umv_X 1zl7_A 1z76_A* 1u73_A* 1vap_A 3r0l_A Back     alignment and structure
>2h4c_B Phospholipase A2-II; non-inhibitor acidic PLA2, basic PLA2, heterodimer, hydrolase; 2.60A {Daboia russellii siamensis} Back     alignment and structure
>1mc2_A Acutohaemonlysin, phospholipase A2; YS49-phospholipase A2, snake venom, toxin; 0.85A {Deinagkistrodon acutus} SCOP: a.133.1.2 PDB: 1mg6_A 1pa0_A 3i03_A* 3hzd_A 3hzw_A* 3cxi_A* 3i3h_A 3i3i_A 1pc9_A 2q2j_A 3cyl_A* 1qll_A* 1xxs_A* 3qnl_A* 2ok9_A* 3iq3_A* 2h8i_A* 3mlm_A* 1y4l_A* 1clp_A* ... Back     alignment and structure
>1g0z_A Phospholipase A2; toxin; 2.18A {Bungarus caeruleus} SCOP: a.133.1.2 PDB: 1u4j_A* 1g2x_A 2osn_A 1dpy_A 1fe5_A 1tc8_A* 1po8_A* Back     alignment and structure
>4eag_A EG:132E8.2 protein; AMPK, transferase; HET: ATP TAM; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4hg9_A Basic phospholipase A2 B; alpha-helix, glycerophospholipid, venom gland, hydrolase; HET: CIT G3P; 1.60A {Gloydius halys} PDB: 1jia_A 1b4w_A 1c1j_A* Back     alignment and structure
>1oz6_A Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A {Echis carinatus} SCOP: a.133.1.2 Back     alignment and structure
>1vip_A Phospholipase A2; hydrolase, anticoagulant; 2.20A {Daboia russellii russellii} SCOP: a.133.1.2 Back     alignment and structure
>1gmz_A Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bothrops pirajai} SCOP: a.133.1.2 Back     alignment and structure
>2qrd_A SNF1-like protein kinase SSP2; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} SCOP: d.129.6.2 PDB: 2ooy_A* 2qr1_A* 2qrc_A* 2oox_A* 2qre_A* Back     alignment and structure
>2v8q_A 5'-AMP-activated protein kinase catalytic subunit; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.129.6.2 PDB: 2v92_A* 2v9j_A* 2y94_C* Back     alignment and structure
>2y8l_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, serine/threonine-protein KI; HET: ADP AMP; 2.50A {Rattus norvegicus} PDB: 2y8q_A* 2ya3_A* Back     alignment and structure
>4eai_A 5'-AMP-activated protein kinase catalytic subunit linker, 5'-AMP-activated protein...; AMPK, transferase; HET: AMP; 2.29A {Rattus norvegicus} PDB: 4eaj_A* 4eak_A* 4eal_A* Back     alignment and structure
>3t4n_A Carbon catabolite-derepressing protein kinase; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} SCOP: d.129.6.2 PDB: 3tdh_A* 3te5_A* 2qlv_A Back     alignment and structure
>3ntt_A Capsid protein; gene therapy vector, cystic fibros sialic acid receptor, icosahedral virus; 3.45A {Adeno-associated virus - 5} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1poca_134 a.133.1.1 (A:) Phospholipase A2 {European honeybee 8e-21
d2v8qa1153 d.129.6.2 (A:396-548) 5'-AMP-activated protein kin 1e-07
d2qrda1127 d.129.6.2 (A:450-576) Snf1-like protein kinase ssp 2e-06
d2qlva1171 d.129.6.2 (A:460-630) Carbon catabolite-derepressi 8e-06
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Length = 134 Back     information, alignment and structure

class: All alpha proteins
fold: Phospholipase A2, PLA2
superfamily: Phospholipase A2, PLA2
family: Insect phospholipase A2
domain: Phospholipase A2
species: European honeybee (Apis mellifera) [TaxId: 7460]
 Score = 78.4 bits (193), Expect = 8e-21
 Identities = 23/53 (43%), Positives = 33/53 (62%)

Query: 22 TKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTR 74
          T WCG G+ +   ++ G F   D+CCR HD+CP+ + A  +K+ LTN  S TR
Sbjct: 6  TLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTR 58


>d2v8qa1 d.129.6.2 (A:396-548) 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 153 Back     information, alignment and structure
>d2qrda1 d.129.6.2 (A:450-576) Snf1-like protein kinase ssp2 {Schizosaccharomyces pombe [TaxId: 4896]} Length = 127 Back     information, alignment and structure
>d2qlva1 d.129.6.2 (A:460-630) Carbon catabolite-derepressing protein kinase SNF1 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1poca_134 Phospholipase A2 {European honeybee (Apis mellifer 100.0
d1g0za_118 Snake phospholipase A2 {Indian krait (Bungarus cae 97.32
d1le6a_123 Phospholipase A2 {Human (Homo sapiens), SPLA2 [Tax 97.1
d1buna_120 Snake phospholipase A2 {Many-banded krait (Bungaru 96.98
d1m8ta_119 Snake phospholipase A2 {King cobra (Ophiophagus ha 96.92
d1sz8a_119 Snake phospholipase A2 {Andaman cobra (Naja sagitt 96.92
d1ae7a_119 Snake phospholipase A2 {Mainland tiger snake (Note 96.84
d1m8ra_124 Snake phospholipase A2 {Snake (Agkistrodon halys) 96.63
d2g58a1121 Snake phospholipase A2 {Snake (Daboia russellii pu 96.54
d1n28a_124 Phospholipase A2 {Human (Homo sapiens), synovial f 96.44
d1jltb_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 96.38
d1gmza_122 Snake phospholipase A2 {Snake (Bothrops pirajai), 96.37
d1jlta_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 96.18
d1p7oa_124 Snake phospholipase A2 {Small-eye snake (Micropech 96.17
d1bjja_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 96.16
d1jiaa_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 96.15
d1ppaa_121 Snake phospholipase A2 {Eastern cottonmouth snake 96.1
d1oz6a_120 Snake phospholipase A2 {Saw-scaled viper (Echis ca 96.1
d1mc2a_122 Snake phospholipase A2 {Hundred-pace snake (Agkist 95.98
d1g4ia_123 Phospholipase A2 {Cow (Bos taurus), pancreas [TaxI 95.85
d1vipa_121 Snake phospholipase A2 {Russell's viper (Vipera ru 95.74
d1zlba1122 Snake phospholipase A2 {Jararacussu (Bothrops jara 95.67
d2qrda1127 Snf1-like protein kinase ssp2 {Schizosaccharomyces 95.46
d2v8qa1153 5'-AMP-activated protein kinase catalytic subunit 95.12
d2qlva1171 Carbon catabolite-derepressing protein kinase SNF1 93.99
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Back     information, alignment and structure
class: All alpha proteins
fold: Phospholipase A2, PLA2
superfamily: Phospholipase A2, PLA2
family: Insect phospholipase A2
domain: Phospholipase A2
species: European honeybee (Apis mellifera) [TaxId: 7460]
Probab=100.00  E-value=1.8e-37  Score=219.13  Aligned_cols=67  Identities=34%  Similarity=0.600  Sum_probs=64.9

Q ss_pred             eeecCcccccCCCCCCCCCCCCCCCccccccccCcCCCCccccCCccCccccCCCcccccccccccc
Q psy16934         17 FKSIRTKWCGTGDIARDISDTGIFHDIDSCCRDHDLCPENIVAKSTKYNLTNDGSFTRRLRKFYWEK   83 (96)
Q Consensus        17 ~i~PGTkWCG~Gn~A~~y~dLG~~~~TD~CCR~HD~Cp~~I~~~~~kygl~N~~~~TisHCdC~~ek   83 (96)
                      +|+|||||||+||+|.+|+|||.+.+||+|||+||+||++|+|++++|||+|.++||||||+|+.++
T Consensus         1 ~i~PGTkWCG~Gn~A~~~~dlG~~~~~D~CCR~HD~Cp~~I~~~~~k~gl~N~~~~TishC~CD~~F   67 (134)
T d1poca_           1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKF   67 (134)
T ss_dssp             CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSSSCEEBHHHHHHH
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchhhHhHccCcccccccccccceecCCccccCCCchHHHH
Confidence            4899999999999999999999999999999999999999999999999999999999999998774



>d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]} Back     information, alignment and structure
>d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} Back     information, alignment and structure
>d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} Back     information, alignment and structure
>d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]} Back     information, alignment and structure
>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} Back     information, alignment and structure
>d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d2g58a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} Back     information, alignment and structure
>d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} Back     information, alignment and structure
>d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]} Back     information, alignment and structure
>d1gmza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]} Back     information, alignment and structure
>d1jlta_ a.133.1.2 (A:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]} Back     information, alignment and structure
>d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]} Back     information, alignment and structure
>d1bjja_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]} Back     information, alignment and structure
>d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} Back     information, alignment and structure
>d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1g4ia_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} Back     information, alignment and structure
>d1vipa_ a.133.1.2 (A:) Snake phospholipase A2 {Russell's viper (Vipera russelli) [TaxId: 8707]} Back     information, alignment and structure
>d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} Back     information, alignment and structure
>d2qrda1 d.129.6.2 (A:450-576) Snf1-like protein kinase ssp2 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qa1 d.129.6.2 (A:396-548) 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qlva1 d.129.6.2 (A:460-630) Carbon catabolite-derepressing protein kinase SNF1 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure