Diaphorina citri psyllid: psy16948

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MQFKKRFLLVLLSCAFLAFCYFGGYRLKHKQTKVLDEFSEDWIDLNHEKDIESSPYLRRLGGDVLPNNQKCRMETCFDFTKCIGDNFKVYIYPSNPDEEPNTISSLYQKVLDVVKESRYYTDDPSQACIFILAIDTLDRDPLSSNYVHNVPSKLLKLKHWNNGKNHIVFNLFSGTWPDYLEEDLGFDTGQAILAKASMSVTHFRTGFDVSIPLFQKDLPERGGEPGAVISNNFPLRKKYILAFKGKRYVYGIGSEVRNSLYHLHNGADMVLVTTCKHGKNWAENKDGRCSVDNAMYD
cccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHccccccccccccEEEEEEEccccccccccccccccHHHHHccccccccccEEEEEECccccccccccccccccccEEEEEEccccccccccccEEEcccccccccccccccccccccccccccEEEEEEEEEEcccccHHHHHHHcccccccccEEEEcccccccccccccccccccccccc
**FKKRFLLVLLSCAFLAFCYFGGYRLKHKQ*******************************DV***NQKCRMETCFDFTKCIGDNFKVYIYPSNPDEEPNTISSLYQKVLDVVKESRYYTDDPSQACIFILAIDTLDRDPLSSNYVHNVPSKLLKLKHWNNGKNHIVFNLFSGTWPDYLEEDLGFDTGQAILAKASMSVTHFRTGFDVSIPLFQKDLPERGGEPGAVISNNFPLRKKYILAFKGKRYVYGIGSEVRNSLYHLHNGADMVLVTTCKHGKNWAENK************
xxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQFKKRFLLVLLSCAFLAFCYFGGYRLKHKQTKVLDEFSEDWIDLNHEKDIESSPYLRRLGGDVLPNNQKCRMETCFDFTKCIGDNFKVYIYPSNPDEEPNTISSLYQKVLDVVKESRYYTDDPSQACIFILAIDTLDRDPLSSNYVHNVPSKLLKLKHWNNGKNHIVFNLFSGTWPDYLEEDLGFDTGQAILAKASMSVTHFRTGFDVSIPLFQKDLPERGGEPGAVISNNFPLRKKYILAFKGKRYVYGIGSEVRNSLYHLHNGADMVLVTTCKHGKNWAENKDGRCSVDNAMYD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Exostosin-1 Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains. Botv is the trigger of heparan sulfate chain initiation and polymerization takes place by a complex of ttv and sotv. Plays a central role in diffusion of morphogens hedgehog (hh), wingless (wg) and decapentaplegic (dpp) via its role in heparan sulfate proteoglycans (HSPGs) biosynthesis which are required for movement of hh, dpp and wg morphogens.confidentQ9V730
Multiple exostoses homolog 1 confidentO01704

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001501 [BP]skeletal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001503 [BP]ossificationprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0006024 [BP]glycosaminoglycan biosynthetic processprobableGO:1901576, GO:0044710, GO:0030203, GO:1901564, GO:1901566, GO:1901137, GO:1901135, GO:0043170, GO:0008150, GO:0071704, GO:0009058, GO:0009059, GO:0006807, GO:0008152, GO:0006022, GO:0006023
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0050508 [MF]glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008375, GO:0008194
GO:0050509 [MF]N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0015020, GO:0008194
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0015014 [BP]heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic processprobableGO:0030201, GO:0044249, GO:0044281, GO:0034645, GO:0016051, GO:0009100, GO:0009101, GO:0044723, GO:1901576, GO:0044264, GO:0044262, GO:0044260, GO:0071704, GO:0043170, GO:0009987, GO:0000271, GO:0044710, GO:0030166, GO:0034637, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0044238, GO:0005975, GO:0006082, GO:0044272, GO:1901137, GO:1901135, GO:0005976, GO:0044237, GO:0033692, GO:0015012, GO:0006029, GO:0006790, GO:0019538
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!