Diaphorina citri psyllid: psy16949


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MYSEVSTFDQDEEAYVCIYSSRNSDTILFHHQGGVDIGDVDAKALKLEIPVGQTGVTEEQVTSKLLINVAPAKKAMVAKFVTALYNMYVNLYFTYLEINPLVVTNDTIYILDLAAKLDSTADFICRAQWGNIDYPPPFGRDAYPEEAYIADLDSKSGASLKLTILNKKGRIWTMVAGGGASVVYSDTICDLGGASELANYGEYSGAPSEQQTYEYAKTILSLMTQEKHPQGK
cCEEcccccccccEEEEEEEEccccEEEEEccccccHHHHcccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEcccEEEEEEccccccccccccccccccccccccccccccHHHHHccccccccccccccEEEcccccEEEEEccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccccc
*YSEVSTFDQDEEAYVCIYSSRNSDTILFHHQGGVDIGDVDAKALKLEIPVGQTGVTEEQVTSKLLINVAPAKKAMVAKFVTALYNMYVNLYFTYLEINPLVVTNDTIYILDLAAKLDSTADFICRAQWGNIDYPPPFGRDAYPEEAYIADLDSKSGASLKLTILNKKGRIWTMVAGGGASVVYSDTICDLGGASELANYGEYSGAPSEQQTYEYAKTILSLMT*E******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSEVSTFDQDEEAYVCIYSSRNSDTILFHHQGGVDIGDVDAKALKLEIPVGQTGVTEEQVTSKLLINVAPAKKAMVAKFVTALYNMYVNLYFTYLEINPLVVTNDTIYILDLAAKLDSTADFICRAQWGNIDYPPPFGRDAYPEEAYIADLDSKSGASLKLTILNKKGRIWTMVAGGGASVVYSDTICDLGGASELANYGEYSGAPSEQQTYEYAKTILSLMTQEKHPQGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-citrate synthase ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.confidentQ32PF2
ATP-citrate synthase ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.confidentP53396
ATP-citrate synthase ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.confidentQ91V92

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003878 [MF]ATP citrate synthase activityprobableGO:0046912, GO:0003824, GO:0016740, GO:0016746, GO:0003674
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006101 [BP]citrate metabolic processprobableGO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0072350
GO:0006633 [BP]fatty acid biosynthetic processprobableGO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0004775 [MF]succinate-CoA ligase (ADP-forming) activityprobableGO:0016878, GO:0016405, GO:0003824, GO:0003674, GO:0004774, GO:0016874, GO:0016877
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019432 [BP]triglyceride biosynthetic processprobableGO:0071704, GO:0045017, GO:0044710, GO:0044238, GO:0006629, GO:0006641, GO:0009987, GO:0006639, GO:0006638, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:1901576, GO:0046486, GO:0044255, GO:0046463, GO:0046460, GO:0008610
GO:0044262 [BP]cellular carbohydrate metabolic processprobableGO:0044238, GO:0005975, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0006112 [BP]energy reserve metabolic processprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0015936 [BP]coenzyme A metabolic processprobableGO:0006732, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0042278, GO:0033875, GO:0071704, GO:0055086, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0034032, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0033865, GO:0006163, GO:1901657, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0035338 [BP]long-chain fatty-acyl-CoA biosynthetic processprobableGO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0008150, GO:0044249, GO:0009058, GO:0046949, GO:0071616, GO:0008152, GO:0006793, GO:0009108, GO:0035336, GO:0035337
GO:0048037 [MF]cofactor bindingprobableGO:0003674, GO:0005488
GO:0006085 [BP]acetyl-CoA biosynthetic processprobableGO:0006084, GO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0044249, GO:0009058, GO:0009108, GO:0071616, GO:0008152, GO:0006793, GO:0008150
GO:0016829 [MF]lyase activityprobableGO:0003824, GO:0003674
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0009346 [CC]citrate lyase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PFF, chain A
Confidence level:very confident
Coverage over the Query: 2-232
View the alignment between query and template
View the model in PyMOL