Diaphorina citri psyllid: psy1694

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------

MHISLLYQHLIIYSIICISGITGEFFTLSGIAIAAGIAYFSPSIINSKFLNGFGGGEACTDKFIQSSNVRVLEEQLKQHVHGQELAISHICGALKNHFQNRYHNTKALAISLHGLPGTGKNYVTDFIVSSIFKRYKDKGTSRFVHKFNSRIHFPNENHVSLYRLQLTNWIISNVTACDRAIFIFDEVDKFPKGLLDVIIPFIDHHAVYNQISFQNTIFLFLSNSGGTEIMNTFLELRKSGERYITIH

cHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccEEEEECccccccHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccEEEECccccccccHHHHHHHcccccccccccccccEEEEEEccccHHHHHHHHHHHHHccccccccc

*HISLLYQHLIIYSIICISGITGEFFTLSGIAIAAGIAYFSPSIINSKFLNGFGGGEACTDKFIQSSNVRVLEEQLKQHVHGQELAISHICGALKNHFQNRYHNTKALAISLHGLPGTGKNYVTDFIVSSIFKRYKDKGTSRFVHKFNSRIHFPNENHVSLYRLQLTNWIISNVTACDRAIFIFDEVDKFPKGLLDVIIPFIDHHAVYNQISFQNTIFLFLSNSGGTEIMNTFLELRK*********

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Torsin-1B	May serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.	confident	Q9ER41
Torsin-1B	May serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.	confident	O14657

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005788 [CC]	endoplasmic reticulum lumen	probable	GO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0000922 [CC]	spindle pole	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0051260 [BP]	protein homooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005818 [CC]	aster	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SXJ, chain D
Confidence level:confident
Coverage over the Query: 79-227
View the alignment between query and template
View the model in PyMOL

Template: 1NY5, chain A
Confidence level:confident
Coverage over the Query: 30-246
View the alignment between query and template
View the model in PyMOL