Diaphorina citri psyllid: psy1695


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
EACTDKFIQSSNVRVLEEQLKQHVHGQELAISHICGALKNHFQNRYHNTKALAISLHGLPGTGKNYVTDFIVSSIFKRYKDKGTSRFVHKFNSRIHFPNENHVSLYRLQLTNWIISNVTACDRAIFIFDEVDKFPKGLLDVIIPFIDHHAVYNQISFQNTIFLFLSNSGGTEIMNTFLELRKSECIEFIFQCQPLKVYLKKL
ccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccEEEECccccccccHHHHHHHHccccccccccccccEEEEEEccccHHHHHHHHHHHHHcHHHHHHHHHccHHHHHccc
EACTDKFIQSSNVRVLEEQLKQHVHGQELAISHICGALKNHFQNRYHNTKALAISLHGLPGTGKNYVTDFIVSSIFKRYKDKGTSRFVHKFNSRIHFPNENHVSLYRLQLTNWIISNVTACDRAIFIFDEVDKFPKGLLDVIIPFIDHHAVYNQISFQNTIFLFLSNSGGTEIMNTFLELRKSECIEFIFQCQPLKVYLKKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EACTDKFIQSSNVRVLEEQLKQHVHGQELAISHICGALKNHFQNRYHNTKALAISLHGLPGTGKNYVTDFIVSSIFKRYKDKGTSRFVHKFNSRIHFPNENHVSLYRLQLTNWIISNVTACDRAIFIFDEVDKFPKGLLDVIIPFIDHHAVYNQISFQNTIFLFLSNSGGTEIMNTFLELRKSECIEFIFQCQPLKVYLKKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R6B, chain X
Confidence level:confident
Coverage over the Query: 12-174
View the alignment between query and template
View the model in PyMOL
Template: 1QVR, chain A
Confidence level:confident
Coverage over the Query: 14-95,113-194
View the alignment between query and template
View the model in PyMOL