Diaphorina citri psyllid: psy16960

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MSTSPSHMIDLKGYCIIIAETPDGKVKLYGSPADKSDLEIGDEILEVNGKTFKDNCNHNEVITHIHDPS
ccccccEEEECccEEEEEEEccccEEEEEcccccccccccccEEEEEccCCccccccHHHHHHHccccc
********IDLKGYCIIIAETPDGKVKLYGSPADKSDLEIGDEILEVNGKTFKDNCNHNEVITHIH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTSPSHMIDLKGYCIIIAETPDGKVKLYGSPADKSDLEIGDEILEVNGKTFKDNCNHNEVITHIHDPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0016327 [CC]apicolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GSL, chain A
Confidence level:very confident
Coverage over the Query: 11-67
View the alignment between query and template
View the model in PyMOL