Diaphorina citri psyllid: psy16969

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MSGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQQSA
cccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
*SGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQ***
xxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQQSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030121 [CC]AP-1 adaptor complexprobableGO:0044464, GO:0030135, GO:0043229, GO:0030117, GO:0012510, GO:0030131, GO:0030130, GO:0030119, GO:0030118, GO:0043227, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0030125, GO:0048475, GO:0005794, GO:0030140, GO:0005798, GO:0030133, GO:0030658, GO:0030659, GO:0012505, GO:0012506, GO:0030120, GO:0030660, GO:0043234, GO:0032991, GO:0043231, GO:0030665, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0031090, GO:0044424, GO:0044425, GO:0044422, GO:0000139
GO:0006836 [BP]neurotransmitter transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0008324 [MF]cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0030122 [CC]AP-2 adaptor complexprobableGO:0043227, GO:0030139, GO:0043229, GO:0071944, GO:0030117, GO:0005905, GO:0030131, GO:0030119, GO:0030118, GO:0030135, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0030132, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0030669, GO:0031988, GO:0044433, GO:0030666, GO:0044459, GO:0048475, GO:0030665, GO:0030659, GO:0030128, GO:0045334, GO:0012505, GO:0012506, GO:0005886, GO:0030120, GO:0030125, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0031090, GO:0044424, GO:0044425, GO:0044422
GO:0015844 [BP]monoamine transportprobableGO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0007267 [BP]cell-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4APS, chain A
Confidence level:probable
Coverage over the Query: 3-72
View the alignment between query and template
View the model in PyMOL