Psyllid ID: psy16969

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MSGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQQSA
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
ccccEccHHHHHHHHHHHHHHHHHHHHHHHHccccccHcHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccc
msgligphlglglgigiLDSALVPLLASVVdsrhtahygsIYALQQTAVSLAYSLgkfvvptkimdlsmpysrqqsa
MSGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQQSA
MSgligphlglglgigilDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQQSA
***LIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDL**********
*SGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQ***
MSGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQQSA
*SGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPY******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSRQQSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query77 2.2.26 [Sep-21-2011]
P54219525 Chromaffin granule amine yes N/A 0.701 0.102 0.481 5e-10
Q01818521 Chromaffin granule amine yes N/A 0.701 0.103 0.481 7e-10
Q8R090521 Chromaffin granule amine yes N/A 0.701 0.103 0.481 3e-09
Q05940514 Synaptic vesicular amine no N/A 0.701 0.105 0.425 8e-09
Q8BRU6517 Synaptic vesicular amine no N/A 0.701 0.104 0.425 8e-09
Q01827515 Synaptic vesicular amine no N/A 0.701 0.104 0.425 9e-09
Q27963517 Synaptic vesicular amine no N/A 0.701 0.104 0.425 1e-08
Q08C75513 Probable vesicular acetyl no N/A 0.831 0.124 0.437 6e-08
P59845493 Probable vesicular acetyl no N/A 0.727 0.113 0.446 2e-07
Q16572532 Vesicular acetylcholine t no N/A 0.649 0.093 0.5 4e-07
>sp|P54219|VMAT1_HUMAN Chromaffin granule amine transporter OS=Homo sapiens GN=SLC18A1 PE=2 SV=1 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 42/54 (77%)

Query: 3   GLIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLG 56
           GLIGP+ GLGL IG++DS+++P++  +VD RHT+ YGS+YA+   A  + +++G
Sbjct: 391 GLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIG 444
Involved in the vesicular transport of biogenic amines.
Homo sapiens (taxid: 9606)
>sp|Q01818|VMAT1_RAT Chromaffin granule amine transporter OS=Rattus norvegicus GN=Slc18a1 PE=2 SV=1 Back     alignment and function description
>sp|Q8R090|VMAT1_MOUSE Chromaffin granule amine transporter OS=Mus musculus GN=Slc18a1 PE=2 SV=1 Back     alignment and function description
>sp|Q05940|VMAT2_HUMAN Synaptic vesicular amine transporter OS=Homo sapiens GN=SLC18A2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BRU6|VMAT2_MOUSE Synaptic vesicular amine transporter OS=Mus musculus GN=Slc18a2 PE=1 SV=1 Back     alignment and function description
>sp|Q01827|VMAT2_RAT Synaptic vesicular amine transporter OS=Rattus norvegicus GN=Slc18a2 PE=1 SV=2 Back     alignment and function description
>sp|Q27963|VMAT2_BOVIN Synaptic vesicular amine transporter OS=Bos taurus GN=SLC18A2 PE=1 SV=1 Back     alignment and function description
>sp|Q08C75|VACHA_DANRE Probable vesicular acetylcholine transporter-A OS=Danio rerio GN=slc18a3a PE=2 SV=1 Back     alignment and function description
>sp|P59845|VACHB_DANRE Probable vesicular acetylcholine transporter-B OS=Danio rerio GN=slc18a3b PE=2 SV=1 Back     alignment and function description
>sp|Q16572|VACHT_HUMAN Vesicular acetylcholine transporter OS=Homo sapiens GN=SLC18A3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
328720866 438 PREDICTED: synaptic vesicular amine tran 0.701 0.123 0.763 1e-15
345478980 458 PREDICTED: synaptic vesicular amine tran 0.896 0.150 0.577 3e-12
307203844 448 Synaptic vesicular amine transporter [Ha 0.896 0.154 0.549 6e-12
322789858 432 hypothetical protein SINV_12304 [Solenop 0.896 0.159 0.549 7e-12
307177629 432 Synaptic vesicular amine transporter [Ca 0.896 0.159 0.549 7e-12
110763268 334 PREDICTED: vesicular acetylcholine trans 0.701 0.161 0.678 8e-12
380024052 430 PREDICTED: LOW QUALITY PROTEIN: synaptic 0.701 0.125 0.678 9e-12
332024923 432 Synaptic vesicular amine transporter [Ac 0.896 0.159 0.549 9e-12
383851806 433 PREDICTED: synaptic vesicular amine tran 0.701 0.124 0.678 1e-11
350425940 430 PREDICTED: synaptic vesicular amine tran 0.740 0.132 0.644 3e-11
>gi|328720866|ref|XP_001948395.2| PREDICTED: synaptic vesicular amine transporter-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 3   GLIGPHLGLGLGIGILDSALVPLLASVVDSRH-TAHYGSIYALQQTAVSLAYSLG 56
           GL  PH GLGLGIGI+DSALVP+LA++VD+RH   HYGS+YALQQTAVSLAYS+G
Sbjct: 304 GLACPHFGLGLGIGIVDSALVPMLANLVDTRHPNVHYGSVYALQQTAVSLAYSVG 358

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345478980|ref|XP_001606328.2| PREDICTED: synaptic vesicular amine transporter-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307203844|gb|EFN82780.1| Synaptic vesicular amine transporter [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322789858|gb|EFZ15005.1| hypothetical protein SINV_12304 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307177629|gb|EFN66688.1| Synaptic vesicular amine transporter [Camponotus floridanus] Back     alignment and taxonomy information
>gi|110763268|ref|XP_001122029.1| PREDICTED: vesicular acetylcholine transporter unc-17-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380024052|ref|XP_003695821.1| PREDICTED: LOW QUALITY PROTEIN: synaptic vesicular amine transporter-like [Apis florea] Back     alignment and taxonomy information
>gi|332024923|gb|EGI65111.1| Synaptic vesicular amine transporter [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383851806|ref|XP_003701422.1| PREDICTED: synaptic vesicular amine transporter-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350425940|ref|XP_003494280.1| PREDICTED: synaptic vesicular amine transporter-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
ZFIN|ZDB-GENE-060929-990513 slc18a3a "solute carrier famil 0.636 0.095 0.448 2.3e-05
UNIPROTKB|F6V4W8516 SLC18A3 "Uncharacterized prote 0.532 0.079 0.512 2.3e-05
UNIPROTKB|E2QRS8517 SLC18A3 "Uncharacterized prote 0.532 0.079 0.512 2.3e-05
RGD|62072530 Slc18a3 "solute carrier family 0.532 0.077 0.512 2.4e-05
UNIPROTKB|Q16572532 SLC18A3 "Vesicular acetylcholi 0.532 0.077 0.512 2.4e-05
WB|WBGene00006756532 unc-17 [Caenorhabditis elegans 0.532 0.077 0.439 3.9e-05
UNIPROTKB|P34711532 unc-17 "Vesicular acetylcholin 0.532 0.077 0.439 3.9e-05
ZFIN|ZDB-GENE-040426-1410493 slc18a3b "solute carrier famil 0.532 0.083 0.487 4.5e-05
UNIPROTKB|F1NJI5428 SLC18A3 "Uncharacterized prote 0.532 0.095 0.487 7.8e-05
UNIPROTKB|E1BK36524 SLC18A3 "Uncharacterized prote 0.532 0.078 0.487 8.1e-05
ZFIN|ZDB-GENE-060929-990 slc18a3a "solute carrier family 18 (vesicular acetylcholine), member 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 109 (43.4 bits), Expect = 2.3e-05, P = 2.3e-05
 Identities = 22/49 (44%), Positives = 32/49 (65%)

Query:    19 DSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDL 67
             D+AL+P LA +VD RH + YGS+YA+   +  +AY+LG  V    + DL
Sbjct:   369 DTALLPTLAFLVDVRHVSVYGSVYAIADISYCVAYALGPIVAGKIVHDL 417
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0015238 "drug transmembrane transporter activity" evidence=IEA
GO:0015893 "drug transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0006836 "neurotransmitter transport" evidence=IEA
UNIPROTKB|F6V4W8 SLC18A3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRS8 SLC18A3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|62072 Slc18a3 "solute carrier family 18 (vesicular acetylcholine), member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q16572 SLC18A3 "Vesicular acetylcholine transporter" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00006756 unc-17 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P34711 unc-17 "Vesicular acetylcholine transporter unc-17" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1410 slc18a3b "solute carrier family 18 (vesicular acetylcholine), member 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJI5 SLC18A3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BK36 SLC18A3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 77
KOG3764|consensus464 99.86
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.09
TIGR00880141 2_A_01_02 Multidrug resistance protein. 96.72
TIGR00900365 2A0121 H+ Antiporter protein. 96.64
TIGR00900 365 2A0121 H+ Antiporter protein. 96.43
PRK09669444 putative symporter YagG; Provisional 96.4
PRK09874408 drug efflux system protein MdtG; Provisional 96.34
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 96.33
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.33
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 96.02
PRK12382392 putative transporter; Provisional 95.96
PRK10504 471 putative transporter; Provisional 95.95
PRK03633381 putative MFS family transporter protein; Provision 95.92
PRK03545390 putative arabinose transporter; Provisional 95.68
TIGR00892455 2A0113 monocarboxylate transporter 1. 95.63
PRK05122399 major facilitator superfamily transporter; Provisi 95.59
TIGR00889418 2A0110 nucleoside transporter. This family of prot 95.58
PRK09848448 glucuronide transporter; Provisional 95.58
PRK10207 489 dipeptide/tripeptide permease B; Provisional 95.54
PRK11646400 multidrug resistance protein MdtH; Provisional 95.43
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 95.4
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 95.37
PRK10429473 melibiose:sodium symporter; Provisional 95.37
PRK10489 417 enterobactin exporter EntS; Provisional 95.31
TIGR00902382 2A0127 phenyl proprionate permease family protein. 95.3
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 95.24
PRK10213 394 nepI ribonucleoside transporter; Reviewed 95.2
TIGR00881379 2A0104 phosphoglycerate transporter family protein 95.19
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 95.15
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 95.12
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 95.1
PRK10504471 putative transporter; Provisional 95.09
PRK03545 390 putative arabinose transporter; Provisional 95.01
TIGR00893 399 2A0114 d-galactonate transporter. 94.9
PRK10489417 enterobactin exporter EntS; Provisional 94.88
TIGR00891 405 2A0112 putative sialic acid transporter. 94.86
TIGR00895 398 2A0115 benzoate transport. 94.84
PRK11646 400 multidrug resistance protein MdtH; Provisional 94.83
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 94.8
PRK05122 399 major facilitator superfamily transporter; Provisi 94.68
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 94.67
PRK09584 500 tppB putative tripeptide transporter permease; Rev 94.6
TIGR00891405 2A0112 putative sialic acid transporter. 94.48
TIGR00897402 2A0118 polyol permease family. This family of prot 94.37
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 94.37
PRK12382 392 putative transporter; Provisional 94.34
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 94.3
PRK10091 382 MFS transport protein AraJ; Provisional 94.19
PRK14995 495 methyl viologen resistance protein SmvA; Provision 94.07
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 94.04
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 94.03
PRK11663 434 regulatory protein UhpC; Provisional 93.97
PRK11195 393 lysophospholipid transporter LplT; Provisional 93.97
PRK15011393 sugar efflux transporter B; Provisional 93.94
TIGR00893399 2A0114 d-galactonate transporter. 93.84
PRK10054395 putative transporter; Provisional 93.7
PRK11010 491 ampG muropeptide transporter; Validated 93.55
TIGR00788468 fbt folate/biopterin transporter. The only functio 93.55
PF13347428 MFS_2: MFS/sugar transport protein 93.53
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 93.45
PRK10213394 nepI ribonucleoside transporter; Reviewed 93.35
PRK15403 413 multidrug efflux system protein MdtM; Provisional 93.32
TIGR00895398 2A0115 benzoate transport. 93.07
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 93.06
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 92.85
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 92.78
PRK03893 496 putative sialic acid transporter; Provisional 92.65
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 92.61
PRK10473 392 multidrug efflux system protein MdtL; Provisional 92.54
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 92.49
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 91.84
PRK15011 393 sugar efflux transporter B; Provisional 91.83
PRK10054 395 putative transporter; Provisional 91.83
KOG2615|consensus 451 91.78
PRK11043 401 putative transporter; Provisional 91.73
PRK09528420 lacY galactoside permease; Reviewed 91.62
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 91.59
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 91.21
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 90.88
PRK14995495 methyl viologen resistance protein SmvA; Provision 90.78
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 90.76
PRK11663434 regulatory protein UhpC; Provisional 90.62
PRK03893496 putative sialic acid transporter; Provisional 90.51
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 90.49
PRK11462460 putative transporter; Provisional 90.33
PRK03699394 putative transporter; Provisional 90.3
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 90.04
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 90.03
PRK12307 426 putative sialic acid transporter; Provisional 89.74
TIGR00896355 CynX cyanate transporter. This family of proteins 89.4
TIGR00892 455 2A0113 monocarboxylate transporter 1. 89.3
PRK11652 394 emrD multidrug resistance protein D; Provisional 89.06
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 88.99
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 88.95
PRK03633 381 putative MFS family transporter protein; Provision 88.73
PRK15402406 multidrug efflux system translocase MdfA; Provisio 88.3
TIGR00901 356 2A0125 AmpG-related permease. 88.01
TIGR00896 355 CynX cyanate transporter. This family of proteins 87.78
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 87.6
KOG4686|consensus459 87.51
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 86.96
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 86.67
PRK09874 408 drug efflux system protein MdtG; Provisional 86.53
PRK11902402 ampG muropeptide transporter; Reviewed 86.51
PRK11652394 emrD multidrug resistance protein D; Provisional 86.5
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 86.39
PRK15462 493 dipeptide/tripeptide permease D; Provisional 86.1
TIGR00897 402 2A0118 polyol permease family. This family of prot 85.87
PRK10133 438 L-fucose transporter; Provisional 84.84
PRK11195393 lysophospholipid transporter LplT; Provisional 84.54
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 84.29
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 84.15
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 83.8
KOG3764|consensus 464 83.18
PRK12307426 putative sialic acid transporter; Provisional 83.09
PRK09952438 shikimate transporter; Provisional 82.66
PRK10133 438 L-fucose transporter; Provisional 82.65
PRK09528 420 lacY galactoside permease; Reviewed 82.58
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 82.33
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 82.18
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 81.71
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 80.61
PRK03699 394 putative transporter; Provisional 80.61
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 80.5
>KOG3764|consensus Back     alignment and domain information 
Probab=99.86  E-value=8.8e-23  Score=163.43  Aligned_cols=72  Identities=38%  Similarity=0.701  Sum_probs=70.6

Q ss_pred             CccchhHHHHHHHHHhhhhhhHHHHHHHHhcCCCC---cchhHHHHHHHHHHHHHhhcccchhhhhhccCccchh
Q psy16969          2 SGLIGPHLGLGLGIGILDSALVPLLASVVDSRHTA---HYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYSR   73 (77)
Q Consensus         2 ~~li~p~~~lG~~ig~vds~~lP~la~lvD~r~~~---~YGsvyAI~~~a~slg~~iGP~~~G~Lv~~igf~~~~   73 (77)
                      .||++|++++|++++++||+++|+|+++||.||++   +||+||||+|++||+||++||.++|.+++++||+|.+
T Consensus       362 ~~L~vp~~~l~~~i~~~dasl~P~l~~lvd~rh~s~~~vYGsVyaIad~a~sla~a~GP~~gg~iv~~iGF~wl~  436 (464)
T KOG3764|consen  362 AQLWVPNFGLGFGIGLADASLIPTLGYLVDPRHVSGFNVYGSVYAIADAAFSLAYAIGPTFGGSLVEAIGFEWLM  436 (464)
T ss_pred             HHHhhhhHHHHHHHHHHHHHHhhhhHHhcchhhccccceeeeHHHHHHHHHHHhhhccccccchheeehhHHHHH
Confidence            57999999999999999999999999999999999   9999999999999999999999999999999999987

>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
2xut_A 524 Proton/peptide symporter family protein; transport 96.8
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 96.66
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 96.37
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 96.13
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 95.95
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 95.14
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 94.1
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 91.71
2cfq_A417 Lactose permease; transport, transport mechanism, 91.48
2xut_A524 Proton/peptide symporter family protein; transport 90.95
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 82.32
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
Probab=96.80  E-value=0.0011  Score=47.93  Aligned_cols=69  Identities=7%  Similarity=0.178  Sum_probs=56.8

Q ss_pred             cchhHHHHHHHHHhhhhhhHHHHHHHHhcCCCCcchhHHHHHHHHHHHHHhhcccchhhhhhccCccch
Q psy16969          4 LIGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYALQQTAVSLAYSLGKFVVPTKIMDLSMPYS   72 (77)
Q Consensus         4 li~p~~~lG~~ig~vds~~lP~la~lvD~r~~~~YGsvyAI~~~a~slg~~iGP~~~G~Lv~~igf~~~   72 (77)
                      ++.-.++.|++.|....+....+.+.++.++.+.....|++.+...++|..+||.++|.+.+..|..|.
T Consensus       112 ~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~g~~~g~~~~~~l~~~~g~~~~  180 (524)
T 2xut_A          112 FYTGLFLIALGSGGIKPLVSSFMGDQFDQSNKSLAQKAFDMFYFTINFGSFFASLSMPLLLKNFGAAVA  180 (524)
T ss_dssp             HHHHHHHHHHHHHTTHHHHHHHHHHTCSTTTTTHHHHHHHHHHHHHHHHHHHHHHTSTHHHHTSCHHHH
T ss_pred             HHHHHHHHHHhccccchhHHHHHHHHcCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccHHHH
Confidence            344567788888888888777788888777766667888889999999999999999999998886553
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 96.88
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 93.5
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 91.19
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]

Probab=96.88  E-value=0.00024  Score=45.49  Aligned_cols=65  Identities=9%  Similarity=-0.026  Sum_probs=50.0

Q ss_pred             chhHHHHHHHHHhhhhhhHHHHHHHHhcCCCCcchhHHHH-HHHHHHHHHhhcccchhhhhhccCccch
Q psy16969          5 IGPHLGLGLGIGILDSALVPLLASVVDSRHTAHYGSIYAL-QQTAVSLAYSLGKFVVPTKIMDLSMPYS   72 (77)
Q Consensus         5 i~p~~~lG~~ig~vds~~lP~la~lvD~r~~~~YGsvyAI-~~~a~slg~~iGP~~~G~Lv~~igf~~~   72 (77)
                      +...++.|++.+...+.....+.+.+   .....|.++++ ++++.++|..+||.++|.+.+.+|+.++
T Consensus       316 ~~~~~l~g~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~g~~i~~~~~G~l~~~~g~~~~  381 (417)
T d1pv7a_         316 VILKTLHMFEVPFLLVGCFKYITSQF---EVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGA  381 (417)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHS---CGGGHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHCHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHC---CHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHH
Confidence            44456678888887777555555555   45557888997 5678899999999999999999998764
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure