Diaphorina citri psyllid: psy16982


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MMSEVDMPVRQAGVVYLKNLITNQWVEKEVDPGTPLAFSLHEQDKAMIRDAIVDAVVMAPEVIRVQLAVCVSNIVKHDFPGKWTQIVDKVSIYLQNPDATPWFGALLCLYQLVKNY
ccccccHHHHHHHHHHHHHcHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcc
***EVDMPVRQAGVVYLKNLITNQWVEKEVDPGTPLAFSLHEQDKAMIRDAIVDAVVMAPEVIRVQLAVCVSNIVKHDFPGKWTQIVDKVSIYLQNPDATPWFGALLCLYQLVKNY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSEVDMPVRQAGVVYLKNLITNQWVEKEVDPGTPLAFSLHEQDKAMIRDAIVDAVVMAPEVIRVQLAVCVSNIVKHDFPGKWTQIVDKVSIYLQNPDATPWFGALLCLYQLVKNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Importin-7 Functions in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter-like protein in association with the importin-beta subunit KPNB1. Acting autonomously, is thought to serve itself as receptor for nuclear localization signals (NLS) and to promote translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with KPNB1 mediates the nuclear import of H1 histone and the Ran-binding site of IPO7 is not required but synergizes with that of KPNB1 in importin/substrate complex dissociation. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In vitro, mediates the nuclear import of HIV-1 reverse transcription complex (RTC) integrase. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.confidentO95373
Importin-7 Functions in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter-like protein in association with the importin-beta subunit KPNB1. Acting autonomously is thought to serve itself as receptor for nuclear localization signals (NLS) and to promote translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with KPNB1 mediates the nuclear import of H1 histone and the Ran-binding site of IPO7 is not required but synergizes with that of KPNB1 in importin/substrate complex dissociation (By similarity). In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones.confidentQ9EPL8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006610 [BP]ribosomal protein import into nucleusprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0051641, GO:0017038, GO:0034613, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WA5, chain C
Confidence level:very confident
Coverage over the Query: 2-116
View the alignment between query and template
View the model in PyMOL