Diaphorina citri psyllid: psy16990

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250

YVRLSYDTRPENILQLFTREWSLELPKLLITVQGGKANFELQPKLKKVLRKGLLKAAKTTGAWVFTGGTNTGVTRQVGDALLMERSQRSGRVVSIGIAPWGIVENNHELIVCRPEQPARLFPIGENNHELIGHNKDVPYHSISSPRSKFAVLNNRHAYFLLVDNGTAGKYGAEIILRRKLEKYISNQKLHPGKSKIVGAKGGENGEPLVFASTNEIWTASLHTSPSNTDAYGTIEFQGGPHPSKAQVRYP

cEEEcccccHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEcccccccccccHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHcccccccccCEEEEccccccccEEEEcccccEEEEECcccccccCEEEEEccccccccccccccc

YVRLSYDTRPENILQLFTREWSLELPKLLITVQGGKANFELQPKLKKVLRKGLLKAAKTTGAWVFTGGTNTGVTRQVGDALLMERSQRSGRVVSIGIAPWGIVENNHELIVCRPEQPARLFPIGENNHELIGHNKDVPYHSISSPRSKFAVLNNRHAYFLLVDNGTAGKYGAEIILRRKLEKYISNQKL******IVGAKGGENGEPLVFASTNEIWTASLHTSPSNTDAYGTIEFQGGPHPS****R**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transient receptor potential cation channel trpm	Calcium channel mediating constitutive calcium ion entry.	confident	A8DYE2
Transient receptor potential cation channel subfamily M member 3	Calcium channel mediating constitutive calcium ion entry. Its activity is increased by reduction in extracellular osmolarity, by store depletion and muscarinic receptor activation.	confident	Q9HCF6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051716 [BP]	cellular response to stimulus	probable	GO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0005261 [MF]	cation channel activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0022890 [MF]	inorganic cation transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0003674
GO:0046873 [MF]	metal ion transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0003674
GO:0007601 [BP]	visual perception	probable	GO:0032501, GO:0044707, GO:0050877, GO:0007600, GO:0050953, GO:0008150, GO:0044699, GO:0003008
GO:0035841 [CC]	new growing cell tip	probable	GO:0060187, GO:0051286, GO:0030427, GO:0044464, GO:0005623, GO:0005575, GO:0035838
GO:0070588 [BP]	calcium ion transmembrane transport	probable	GO:0009987, GO:0070838, GO:0006812, GO:0006811, GO:0006810, GO:0044763, GO:0006816, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0072511, GO:0051234, GO:0055085, GO:0044699
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0009628 [BP]	response to abiotic stimulus	probable	GO:0050896, GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IZ6, chain A
Confidence level:probable
Coverage over the Query: 25-100
View the alignment between query and template
View the model in PyMOL