Diaphorina citri psyllid: psy16996

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27

MYVWMFQRFTVVMEYEQKPALPPPFIILSHILLFIKYLRRKCEGVRETYDNGLKLFLDKEDLERLYDFEEECVEGYFREKETKLAMSTDERIRNTTERVENINQKVEDINQKENSQNSSIQVMSSLAFLRTTLVAFWNSGITDELETVCGLLSPPRSPRLLSPPVPGEIPPPSAISGGPTARNFRRCRHASEMSNPEMAVYLEKEHLRDAEESDYHLMEEIIHTRFNNKEAGSDADKFDNNAFFLTVNEETASEIRANFKKNSLFNIP

ccEEcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccHHcHHHHHHHcccccccccc

MYVWMFQRFTVVMEYEQKPALPPPFIILSHILLFIKYLRRKCEGVRETYDNGLKLFLDKEDLERLYDFEEECVEGYFRE******************RVENINQKVED*************VMSSLAFLRTTLVAFWNSGITDELETVCGLL**************************************************************YHLMEEIIHTRF***********FDNNAFFLTVN**********FKKNSLFNI*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MYVWMFQRFTVVMEYEQKPALPPPFIILSHILLFIKYLRRKCEGVRETYDNGLKLFLDKEDLERLYDFEEECVEGYFREKETKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxENSQNSSIQVMSSLAFLRTTLVAFWNSGITDELETVCGLLSPPRSPRLLSPPVPGEIPPPSAISGGPTARNFRRCRHASEMSNPEMAVYLEKEHLRDAEESDYHLMEEIIHTRFNNKEAGSDADKFDNNAFFLTVNEETASEIRANFKKNSLFNIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005261 [MF]	cation channel activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623
GO:0006812 [BP]	cation transport	probable	GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E7K, chain A
Confidence level:confident
Coverage over the Query: 92-147
View the alignment between query and template
View the model in PyMOL