Diaphorina citri psyllid: psy169


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MAGHLKQDLKLTSCLIKLLRNFNTASAVNPLRQELTTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE
ccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEECcccccccccHHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHccccccccccccccccccHHHHHHcccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccEEEEEECcccccccccccccEEEEEEEEEEEcccccccccccEEEcHHHHHHHHcHHHHHHHHHHHccc
********LKLTSCLIKLLRNFNTA*****************EKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIAD***************MI*********DFVDMGL*******************NVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGHLKQDLKLTSCLIKLLRNFNTASAVNPLRQELTTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
39S ribosomal protein L46, mitochondrial confidentQ5RBU2
39S ribosomal protein L46, mitochondrial confidentQ9H2W6
39S ribosomal protein L46, mitochondrial confidentQ3SZ22

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016787 [MF]hydrolase activityprobableGO:0003824, GO:0003674
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KTG, chain A
Confidence level:very confident
Coverage over the Query: 157-267
View the alignment between query and template
View the model in PyMOL