Diaphorina citri psyllid: psy169

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280

MAGHLKQDLKLTSCLIKLLRNFNTASAVNPLRQELTTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE

ccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEECcccccccccHHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHccccccccccccccccccHHHHHHcccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccEEEEEECcccccccccccccEEEEEEEEEEEcccccccccccEEEcHHHHHHHHcHHHHHHHHHHHccc

********LKLTSCLIKLLRNFNTA*****************EKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIAD***************MI*********DFVDMGL*******************NVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
39S ribosomal protein L46, mitochondrial		confident	Q5RBU2
39S ribosomal protein L46, mitochondrial		confident	Q9H2W6
39S ribosomal protein L46, mitochondrial		confident	Q3SZ22

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016787 [MF]	hydrolase activity	probable	GO:0003824, GO:0003674
GO:0005840 [CC]	ribosome	probable	GO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KTG, chain A
Confidence level:very confident
Coverage over the Query: 157-267
View the alignment between query and template
View the model in PyMOL