Psyllid ID: psy169

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MAGHLKQDLKLTSCLIKLLRNFNTASAVNPLRQELTTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE
ccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHccccccccccccccccccHHHHHHcccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccEEEEEEEcccccccccccccEEEEEEEEEEEcccccccccccEEEcHHHHHHHHcHHHHHHHHHHHccc
cccccccccccHHHHHHHHHHccHHHHcccccccccccccccccccEEEEEEEEcccEEcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHccccHHHHHHHHHHHHHcccccccccHccccccccHHHHHHcccEEEEEEEccccccEEEcccccccccccHHHHHHHHHHHHcccccEEEEEccccEEEEEEcccccccccccccccEEEEEEEEEEccccccccccEEEEcHHHHHHHccHHHHHHHHHHHccc
maghlkqdLKLTSCLIKLLRNfntasavnplrqeltttsgsrekWDLMSAVClerkplitrDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNelkkftpasritkadkENNVKSMQRKLDKHLVLLIKEKlgdkshwimpfgkrqegeTMRQTAERILAEKFNKTIHarfygnapcgfykfkypkslqaesnVVGAKLFFFKAQYlegdvkdkkLEYTWAAREELPKLLLEDYNKNISLFLMDE
MAGHLKQDLKLTSCLIKLLRNfntasavnplrqeltttsgsrekwdlMSAVCLerkplitrdfNEIEKKVQLLMNELELensmksdheLRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKkftpasritkadkennvksmqRKLDKHLVLLIKeklgdkshwimpfgkrqegetMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAqylegdvkdKKLEYTWAAREelpkllledYNKNISLFLMDE
MAGHLKQDLKLTSCLIKLLRNFNTASAVNPLRQELTTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQllmnelelenSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE
********LKLTSCLIKLLRNFNTASAVNPLRQ*L******REKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELE**********LRCIAD***************MI*********DFVDMGL***************************LDKHLVLLIKEKLGDKSHWIMPFGK*********TAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFL***
*************CLIKLLRN*************************LMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHE**********************************************************NVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFK*************AKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE
MAGHLKQDLKLTSCLIKLLRNFNTASAVNPLRQELTTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE
*****K*DLKLTSCLIKLLRNFNTA*****************EKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAE*******NVDMID****QTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLM**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGHLKQDLKLTSCLIKLLRNFNTASAVNPLRQELTTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREELPKLLLEDYNKNISLFLMDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q5RK00277 39S ribosomal protein L46 yes N/A 0.85 0.859 0.429 2e-50
Q3SZ22277 39S ribosomal protein L46 yes N/A 0.85 0.859 0.401 4e-48
Q9EQI8283 39S ribosomal protein L46 yes N/A 0.803 0.795 0.436 5e-48
Q9H2W6279 39S ribosomal protein L46 yes N/A 0.85 0.853 0.385 6e-45
Q5RBU2279 39S ribosomal protein L46 yes N/A 0.85 0.853 0.390 2e-43
P36528281 54S ribosomal protein L17 yes N/A 0.771 0.768 0.235 8e-06
>sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 Back     alignment and function desciption
 Score =  199 bits (506), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 154/249 (61%), Gaps = 11/249 (4%)

Query: 36  TTTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQ 95
              S SR  W L  A+CL+R PLIT+    +++++  L+ ++E+E S+ SDHELR + + 
Sbjct: 34  AAPSSSRSPWRLSGALCLQRPPLITKPLTPLQEEMAGLLQQVEVERSLYSDHELRALDEA 93

Query: 96  IRAEKMKDKSLNVDMIDDALQQ---TGQDFVDMGLNELKKFTPASRITKADKENNVKSMQ 152
            R  K K      D+ D+   Q     QD  DM   E  +F P +R T+ADK+N+  S+ 
Sbjct: 94  QRLAKKK-----ADLYDEEQDQDVTLAQDLEDMWEQEFLQFRPGARETEADKKNDRTSLH 148

Query: 153 RKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPC 212
           RKLD++L+LL++EKLGD+  W++P  + Q GET+R TAERILA      + A+F GNAPC
Sbjct: 149 RKLDRNLILLVREKLGDQDLWMLPQVEWQPGETLRGTAERILATLSENNMEAKFLGNAPC 208

Query: 213 GFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDV--KDKKLEYTWAAREELPKLLLEDYN 270
           G YKFK+PK+++ ES+ +G K+FFFKA  L GD     KK  + WA++EEL   L   Y 
Sbjct: 209 GHYKFKFPKAIRTESD-LGVKVFFFKALLLTGDFVQTGKKGRHVWASKEELGDYLQPKYL 267

Query: 271 KNISLFLMD 279
             +  FL+D
Sbjct: 268 AQVRRFLLD 276

Rattus norvegicus (taxid: 10116)
>sp|Q3SZ22|RM46_BOVIN 39S ribosomal protein L46, mitochondrial OS=Bos taurus GN=MRPL46 PE=2 SV=1 Back     alignment and function description
>sp|Q9EQI8|RM46_MOUSE 39S ribosomal protein L46, mitochondrial OS=Mus musculus GN=Mrpl46 PE=2 SV=1 Back     alignment and function description
>sp|Q9H2W6|RM46_HUMAN 39S ribosomal protein L46, mitochondrial OS=Homo sapiens GN=MRPL46 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBU2|RM46_PONAB 39S ribosomal protein L46, mitochondrial OS=Pongo abelii GN=MRPL46 PE=2 SV=1 Back     alignment and function description
>sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
328719800266 PREDICTED: 39S ribosomal protein L46, mi 0.853 0.898 0.491 1e-61
239790236266 ACYPI003428 [Acyrthosiphon pisum] 0.853 0.898 0.487 1e-60
91077572255 PREDICTED: similar to mitochondrial ribo 0.867 0.952 0.451 3e-57
307194188267 39S ribosomal protein L46, mitochondrial 0.839 0.880 0.471 6e-54
291237298280 PREDICTED: mitochondrial ribosomal prote 0.846 0.846 0.438 7e-53
170058857272 mitochondrial ribosomal protein, L46 [Cu 0.85 0.875 0.432 8e-52
157124369267 mitochondrial ribosomal protein, L46, pu 0.871 0.913 0.421 8e-51
195490567258 GE21186 [Drosophila yakuba] gi|194179294 0.857 0.930 0.432 8e-51
194747036258 GF24835 [Drosophila ananassae] gi|190623 0.857 0.930 0.444 1e-50
195125355262 GI12544 [Drosophila mojavensis] gi|19391 0.925 0.988 0.405 2e-50
>gi|328719800|ref|XP_003246863.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 173/242 (71%), Gaps = 3/242 (1%)

Query: 39  SGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRA 98
           S ++ KWD+M+ +CL+RKP+IT+   + E   Q ++ E+E E S+KSDHELR   D  R 
Sbjct: 18  STTQVKWDIMAGLCLQRKPIITKPLTDTEVNFQNILQEIEFEKSLKSDHELRHEKDVKRM 77

Query: 99  EKMKD-KSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDK 157
           EK+K+ K ++ D +D A  Q+ QD+VD    EL  F  ASR+T+AD  N+ KS++RKLD 
Sbjct: 78  EKLKNGKVIDFDDMDQASNQSAQDYVDKNKEELLNFKFASRLTEADTINDTKSLKRKLDD 137

Query: 158 HLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKF 217
           +LVL++K+KLG + +W++P G  ++GET+R+T+ERIL E     I+ RFYGNAPCGFYK+
Sbjct: 138 NLVLIVKQKLGHEDYWVLPQGLWKDGETLRETSERILKESCGNNINVRFYGNAPCGFYKY 197

Query: 218 KYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKK--LEYTWAAREELPKLLLEDYNKNISL 275
           KYPK  + +SNV GAK+FFFKA+ L+G+V++K    +Y W+  +EL K L++ Y KN+ L
Sbjct: 198 KYPKQKREQSNVEGAKIFFFKAKLLDGNVEEKGTWTDYEWSTVQELNKRLIQPYMKNVKL 257

Query: 276 FL 277
           FL
Sbjct: 258 FL 259

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|239790236|dbj|BAH71691.1| ACYPI003428 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91077572|ref|XP_972780.1| PREDICTED: similar to mitochondrial ribosomal protein, L46, putative [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307194188|gb|EFN76605.1| 39S ribosomal protein L46, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|291237298|ref|XP_002738570.1| PREDICTED: mitochondrial ribosomal protein L46-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|170058857|ref|XP_001865107.1| mitochondrial ribosomal protein, L46 [Culex quinquefasciatus] gi|167877783|gb|EDS41166.1| mitochondrial ribosomal protein, L46 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157124369|ref|XP_001660444.1| mitochondrial ribosomal protein, L46, putative [Aedes aegypti] gi|108874035|gb|EAT38260.1| AAEL009833-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195490567|ref|XP_002093193.1| GE21186 [Drosophila yakuba] gi|194179294|gb|EDW92905.1| GE21186 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194747036|ref|XP_001955960.1| GF24835 [Drosophila ananassae] gi|190623242|gb|EDV38766.1| GF24835 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195125355|ref|XP_002007144.1| GI12544 [Drosophila mojavensis] gi|193918753|gb|EDW17620.1| GI12544 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
FB|FBgn0035272258 mRpL46 "mitochondrial ribosoma 0.857 0.930 0.411 6.9e-47
MGI|MGI:1914558283 Mrpl46 "mitochondrial ribosoma 0.842 0.833 0.425 6.2e-46
RGD|1309123277 Mrpl46 "mitochondrial ribosoma 0.839 0.848 0.422 1.3e-45
UNIPROTKB|Q5RK00277 Mrpl46 "39S ribosomal protein 0.839 0.848 0.422 1.3e-45
UNIPROTKB|E2R6F9280 MRPL46 "Uncharacterized protei 0.921 0.921 0.405 3.4e-45
UNIPROTKB|F6XH70299 MRPL46 "Uncharacterized protei 0.921 0.862 0.405 3.4e-45
UNIPROTKB|F1N499277 MRPL46 "39S ribosomal protein 0.85 0.859 0.403 5e-44
UNIPROTKB|Q3SZ22277 MRPL46 "39S ribosomal protein 0.85 0.859 0.403 5e-44
UNIPROTKB|F1SRT0279 LOC100523040 "Uncharacterized 0.85 0.853 0.395 9.3e-43
UNIPROTKB|Q9H2W6279 MRPL46 "39S ribosomal protein 0.85 0.853 0.378 9.6e-41
FB|FBgn0035272 mRpL46 "mitochondrial ribosomal protein L46" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 491 (177.9 bits), Expect = 6.9e-47, P = 6.9e-47
 Identities = 100/243 (41%), Positives = 149/243 (61%)

Query:    37 TTSGSREKWDLMSAVCLERKPLITRDFNEIEKKVQXXXXXXXXXXSMKSDHELRCIADQI 96
             +++ S EKWDL + V +ER P++++  N +EK+ Q          S+KSDHEL+   + +
Sbjct:    18 SSTASAEKWDLYAGVLVERLPVVSKSLNPLEKQFQDLLWRVEYENSLKSDHELKHEREIV 77

Query:    97 RAEKMKDKSLNVDMIDDALQQTGQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLD 156
             +AE +K   + VD+ D   +QT QD  D  + ELKKF   SR T  D+ N   S  R LD
Sbjct:    78 QAELIKQGKIQVDLEDAGSKQTAQDLKDAYVEELKKFQLGSRTTPDDQANRTTSTDRCLD 137

Query:   157 KHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYK 216
               L LL+++KLG + H I+P GKR+EGE+MRQTAER+L E   + +   FYGNAP GF+K
Sbjct:   138 DTLYLLVQQKLGQQEHLILPQGKREEGESMRQTAERVLRESCGQELQVLFYGNAPVGFHK 197

Query:   217 FKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKKLEYTWAAREEL-PKLLLEDYNKNISL 275
             +KYP++ + E+  VGAK+FF++A    G V +   ++ W  +E L  KL    Y +++  
Sbjct:   198 YKYPRNQRTET--VGAKVFFYRASLRSGQVPENLTKFEWLPKEALNEKLTNTAYAQSVKK 255

Query:   276 FLM 278
             FL+
Sbjct:   256 FLL 258
GO:0005762 "mitochondrial large ribosomal subunit" evidence=ISS
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0016787 "hydrolase activity" evidence=IEA
GO:0032543 "mitochondrial translation" evidence=IC
MGI|MGI:1914558 Mrpl46 "mitochondrial ribosomal protein L46" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309123 Mrpl46 "mitochondrial ribosomal protein L46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RK00 Mrpl46 "39S ribosomal protein L46, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6F9 MRPL46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XH70 MRPL46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N499 MRPL46 "39S ribosomal protein L46, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ22 MRPL46 "39S ribosomal protein L46, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRT0 LOC100523040 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2W6 MRPL46 "39S ribosomal protein L46, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RK00RM46_RATNo assigned EC number0.42970.850.8592yesN/A
Q9EQI8RM46_MOUSENo assigned EC number0.43640.80350.7950yesN/A
Q5RBU2RM46_PONABNo assigned EC number0.39090.850.8530yesN/A
Q3SZ22RM46_BOVINNo assigned EC number0.40160.850.8592yesN/A
Q9H2W6RM46_HUMANNo assigned EC number0.38550.850.8530yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
cd04661132 cd04661, MRP_L46, Mitochondrial ribosomal protein 2e-51
pfam11788121 pfam11788, MRP-L46, 39S mitochondrial ribosomal pr 2e-09
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup 1e-07
pfam00293133 pfam00293, NUDIX, NUDIX domain 3e-04
>gnl|CDD|240019 cd04661, MRP_L46, Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information 
 Score =  164 bits (418), Expect = 2e-51
 Identities = 68/133 (51%), Positives = 97/133 (72%), Gaps = 3/133 (2%)

Query: 146 NNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHAR 205
           N+ KS+ RKLD  LVLL+++K+G ++HWI+P GKR+EGET+RQTAER L E     + A+
Sbjct: 1   NDRKSLDRKLDDTLVLLVQQKVGSQNHWILPQGKREEGETLRQTAERTLKELCGNNLKAK 60

Query: 206 FYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDK--KLEYTWAAREELPK 263
           FYGNAP GFYK+KYPK+++ E   VGAK+FFFKA+Y+ G  +    ++++ W A+EEL K
Sbjct: 61  FYGNAPVGFYKYKYPKAVRNEGI-VGAKVFFFKARYMSGQFELSQNQVDFKWLAKEELQK 119

Query: 264 LLLEDYNKNISLF 276
            L   Y +++  F
Sbjct: 120 YLNPPYLQSVKKF 132

MRPs are thought to be involved in the maintenance of the mitochondrial DNA. In general, members of the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for activity and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. MRP L46 appears to contain a modified nudix motif. Length = 132
>gnl|CDD|221223 pfam11788, MRP-L46, 39S mitochondrial ribosomal protein L46 Back     alignment and domain information
>gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
KOG4548|consensus263 100.0
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 100.0
PF11788111 MRP-L46: 39S mitochondrial ribosomal protein L46 ; 99.82
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.6
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.56
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.55
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.54
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.54
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.53
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.53
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.51
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.51
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.49
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.49
PLN02325144 nudix hydrolase 99.48
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.48
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.48
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.48
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.48
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.47
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.47
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.46
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.46
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.46
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.44
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.44
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.44
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.44
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.44
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.43
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.43
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.43
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.43
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.43
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.41
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.41
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.41
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.41
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.41
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.4
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.39
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.38
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.37
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.36
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.36
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.35
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.34
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.33
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.31
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.3
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.29
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.28
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.27
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.27
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.26
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.26
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.24
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.22
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.21
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.2
PRK08999 312 hypothetical protein; Provisional 99.2
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.2
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.18
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.14
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.13
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.07
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.05
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.02
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.01
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 98.96
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 98.94
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 98.9
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 98.88
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 98.87
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 98.85
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 98.8
PRK10707190 putative NUDIX hydrolase; Provisional 98.71
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 98.64
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 98.57
PLN02709222 nudix hydrolase 98.47
KOG2839|consensus145 98.4
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 98.3
PLN02552247 isopentenyl-diphosphate delta-isomerase 98.28
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 98.2
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 98.13
PLN02791 770 Nudix hydrolase homolog 98.05
KOG3084|consensus345 98.04
PLN03143291 nudix hydrolase; Provisional 98.0
KOG0648|consensus295 96.84
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 96.52
KOG4195|consensus275 96.38
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 96.31
KOG3069|consensus246 96.18
KOG3041|consensus225 96.17
PLN02839372 nudix hydrolase 95.5
PRK10880350 adenine DNA glycosylase; Provisional 93.97
KOG2937|consensus 348 92.01
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 90.55
KOG0142|consensus225 85.82
PRK13910289 DNA glycosylase MutY; Provisional 80.39
>KOG4548|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-54  Score=382.35  Aligned_cols=240  Identities=33%  Similarity=0.518  Sum_probs=209.8

Q ss_pred             CCCCCCceEEEEEEeeeCCcccCCCCHHHHHHHHHHHHHHHhhccCChHHHhHHHHHHHHHHhhccCCCCccchhHHhhh
Q psy169           39 SGSREKWDLMSAVCLERKPLITRDFNEIEKKVQLLMNELELENSMKSDHELRCIADQIRAEKMKDKSLNVDMIDDALQQT  118 (280)
Q Consensus        39 ~~~~~~w~i~~av~L~R~Pvit~~~~~~E~~~~~~~~~~e~e~sl~s~~e~~~~~e~~~~~~~~~g~~~~~~~~~~~~~~  118 (280)
                      .+++.+|+|++||+|+|+|||+++||++|++||.|+.++|.|+++++|||++...+..++.......-.++.+++....+
T Consensus        20 tass~p~~~~~gvll~R~Pvv~~~~se~EK~~~~ll~e~e~e~sl~~dhel~~~qe~~~~~~q~~~~~e~~~eDe~~~i~   99 (263)
T KOG4548|consen   20 TASSQPWKIFAGVLLSRLPVVAPPLSELEKRFYSLLMELEQEKSLKPDHELKAFQEEKEKAWQAQLRKEVDEEDEFIGIT   99 (263)
T ss_pred             ccCCCchhhhHHhhhhhcccccCCCCHHHHHHHHHHHHHHHHhccCCcHHHHHHHHHHHHHHHHHHHHhhcccchhhHHH
Confidence            34458999999999999999999999999999999999999999999999998877332222211111112233444668


Q ss_pred             ccchhhhhhhcccCCCCCCCCccchhcCCccchhhcCCCcEEEEEEecCCCCCceecCCeec-CCCCCHHHHHHHHHHHH
Q psy169          119 GQDFVDMGLNELKKFTPASRITKADKENNVKSMQRKLDKHLVLLIKEKLGDKSHWIMPFGKR-QEGETMRQTAERILAEK  197 (280)
Q Consensus       119 ~~d~ed~~~~~~~~f~p~~R~T~aD~~nd~~SL~R~l~~~LyLLVk~~~g~~~~W~FP~G~v-e~gEtl~qaAeRel~Ee  197 (280)
                      ++|.+|+|.+++.+|.-..|+||||.+||++||+|+||++|||||+++.|..++|.||++.+ ..|++||.+|+|.|+..
T Consensus       100 ~~~~kd~~~~~~~~~~~~~RiTEaD~kNd~kSl~R~Ldr~LyLLV~~k~g~~s~w~fP~~~~s~~~~~lr~~ae~~Lk~~  179 (263)
T KOG4548|consen  100 ANDRKDMWKKDLLDFDLPFRITEADPKNDRKSLERELDRKLYLLVKRKFGKSSVWIFPNRQFSSSEKTLRGHAERDLKVL  179 (263)
T ss_pred             HHHHHHHHHHHhhcccccccccCCCcccchhHHHHHhcceEEEEEeeccCccceeeCCCcccCCccchHHHHHHHHHHHH
Confidence            89999999999888876669999999999999999999999999998888889999999999 99999999999999999


Q ss_pred             hCCceEEEEecccceEEEEeeCCccccccccccceEEEEEEEEEeCCCC--CCCccceEeeccccccccccHHHHHHHHh
Q psy169          198 FNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFFKAQYLEGDV--KDKKLEYTWAAREELPKLLLEDYNKNISL  275 (280)
Q Consensus       198 ~G~~i~v~~vg~~P~g~~~~~yp~~~~~~~~~~g~kvfffka~~~~G~~--~~e~~d~~WltkeEl~~~l~~~y~~~v~~  275 (280)
                      +|.++.+||+||+|+||+.+++|...+...+ +|.++|||+|.+.+|+.  +....||.|||++||.+|+++.|+.+|++
T Consensus       180 ~ge~~~t~fvgnaP~g~~~~q~pr~~~~e~~-~~sk~ff~k~~lv~~~~~kn~n~edfvWvTkdel~e~l~~~~~~~vK~  258 (263)
T KOG4548|consen  180 SGENKSTWFVGNAPFGHTPLQSPREMTTEEP-VSSKVFFFKASLVANSNQKNQNKEDFVWVTKDELGEKLPKFAKAQVKH  258 (263)
T ss_pred             hcchhhhheeccCccccccccCccccccccc-ccceeEEeeeeeccccchhcccccceEEechHHHhhhcchHHHHhhhh
Confidence            9999999999999999999999988766654 68999999999999987  35678999999999999999999999999


Q ss_pred             hhhc
Q psy169          276 FLMD  279 (280)
Q Consensus       276 ~L~d  279 (280)
                      +|+|
T Consensus       259 ilsD  262 (263)
T KOG4548|consen  259 ILSD  262 (263)
T ss_pred             hccC
Confidence            9987

>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PF11788 MRP-L46: 39S mitochondrial ribosomal protein L46 ; InterPro: IPR021757 This is the L46 subunit of the mammalian mitochondrial ribosome, conserved from plants and fungi Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>KOG2839|consensus Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>KOG3084|consensus Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>KOG0648|consensus Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG4195|consensus Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>KOG3069|consensus Back     alignment and domain information
>KOG3041|consensus Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>KOG2937|consensus Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>KOG0142|consensus Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 4e-07
3grn_A153 MUTT related protein; structural genomics, hydrola 8e-07
3son_A149 Hypothetical nudix hydrolase; structural genomics, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2b06_A155 MUTT/nudix family protein; structural genomics, P 2e-05
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 3e-05
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 7e-05
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, 8e-05
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 9e-05
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 1e-04
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 2e-04
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 4e-04
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 4e-04
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 6e-04
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 7e-04
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 7e-04
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 Back     alignment and structure
 Score = 48.0 bits (114), Expect = 4e-07
 Identities = 18/118 (15%), Positives = 42/118 (35%), Gaps = 7/118 (5%)

Query: 160 VLLIKEKLG-DKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFK 218
            LL K      + +W +P G+ Q+ ET+    ER+   +    +          G ++  
Sbjct: 32  FLLGKRTNRPAQGYWFVPGGRVQKDETLEAAFERLTMAELG--LRLPITAGQFYGVWQHF 89

Query: 219 YPKSLQAESNVVGAKLFFFKAQYLEGDVK---DKKLEYTWAAREELPKL-LLEDYNKN 272
           Y  +           +  F+ +  E ++    ++  +Y W   + L     +   ++ 
Sbjct: 90  YDDNFSGTDFTTHYVVLGFRFRVSEEELLLPDEQHDDYRWLTSDALLASDNVHANSRA 147
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.7
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.65
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.61
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.6
3grn_A153 MUTT related protein; structural genomics, hydrola 99.6
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.6
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.59
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.58
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.57
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.57
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.56
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.56
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.56
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.55
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.55
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.55
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.54
3exq_A161 Nudix family hydrolase; protein structure initiati 99.54
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.53
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.53
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.53
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.53
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.52
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.52
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.52
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.51
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.5
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.49
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.48
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.46
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.46
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.46
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.44
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.44
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.44
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.42
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.42
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.42
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.4
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.4
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.4
3f13_A163 Putative nudix hydrolase family member; structural 99.39
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.38
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.38
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.37
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.35
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.34
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.32
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.3
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.29
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.29
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.28
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.27
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.27
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.27
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.25
2fb1_A226 Conserved hypothetical protein; structural genomic 99.25
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.25
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.25
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.24
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.24
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.2
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 99.15
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.15
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.15
2fml_A273 MUTT/nudix family protein; structural genomics, PS 99.13
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.13
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 99.08
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.04
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 98.97
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 98.97
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 98.85
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 98.7
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 98.66
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 98.64
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 98.62
3bho_A208 Cleavage and polyadenylation specificity factor su 98.07
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
Probab=99.70  E-value=5.3e-17  Score=132.01  Aligned_cols=99  Identities=23%  Similarity=0.240  Sum_probs=75.8

Q ss_pred             cEEEEEEecCCCCCceecCCeecCCCCCHHHHHHHHHHHHhCCceEEEEecccceEEEEeeCCccccccccccceEEEEE
Q psy169          158 HLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFF  237 (280)
Q Consensus       158 ~LyLLVk~~~g~~~~W~FP~G~ve~gEtl~qaAeRel~Ee~G~~i~v~~vg~~P~g~~~~~yp~~~~~~~~~~g~kvfff  237 (280)
                      ..+||++++   .|.|.||||++++|||+.+||.||+.||+|+++.+.    .+++.+.|.|+...    ......++||
T Consensus        15 ~~vLL~~r~---~g~W~~PgG~ve~gEt~~~aa~RE~~EEtGl~~~~~----~~l~~~~~~~~~~~----~~~~~~~~~f   83 (134)
T 3i7u_A           15 GEVLLIKTP---SNVWSFPKGNIEPGEKPEETAVREVWEETGVKGEIL----DYIGEIHYWYTLKG----ERIFKTVKYY   83 (134)
T ss_dssp             TEEEEEECT---TSCEECCEEECCTTCCHHHHHHHHHHHHHSEEEEEE----EEEEEEEEEEEETT----EEEEEEEEEE
T ss_pred             CEEEEEEeC---CCcEECCeeEecCCCCHHHHHHHHHHHhcCceEEEe----eeeeeeeEEecCCC----ceEEEEEEEE
Confidence            358999986   357999999999999999999999999999987642    23444444333211    0123567899


Q ss_pred             EEEEeCCCCC--CCccceEeeccccccccccH
Q psy169          238 KAQYLEGDVK--DKKLEYTWAAREELPKLLLE  267 (280)
Q Consensus       238 ka~~~~G~~~--~e~~d~~WltkeEl~~~l~~  267 (280)
                      .|...+|++.  .++.+++|++.+|+.+++..
T Consensus        84 ~~~~~~~~~~~~~E~~~~~W~~~~e~~~~l~~  115 (134)
T 3i7u_A           84 LMKYKEGEPRPSWEVKDAKFFPIKEAKKLLKY  115 (134)
T ss_dssp             EEEEEEECCCCCTTSSEEEEEEHHHHHHHBCS
T ss_pred             EEEEcCCcCcCChhheEEEEEEHHHHhhhcCC
Confidence            9999988874  57899999999999998653
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1xsba_153 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 6e-10
d1vcda1126 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t 6e-08
d1vk6a2131 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher 3e-07
d1sjya_158 d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc 2e-06
d1ryaa_160 d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD 5e-06
d2fmla2202 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N 8e-06
d2azwa1147 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E 5e-05
d1q33a_292 d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr 4e-04
d2a6ta2151 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c 9e-04
d1irya_156 d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha 0.002
d2fvva1135 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat 0.002
d1ktga_137 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 0.003
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.4 bits (130), Expect = 6e-10
 Identities = 19/120 (15%), Positives = 35/120 (29%), Gaps = 9/120 (7%)

Query: 156 DKHLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFY 215
           +    LL++   G   HW  P G  + GE   +TA R   E+                  
Sbjct: 27  NAIEFLLLQASDG-IHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEGFKREL 85

Query: 216 KFKYPKSLQAESNVVGAKLFFFKAQYLEGDVKDKK--LEYTWAAREELPKLLLEDYNKNI 273
            +      +          +  + +  + +++       Y W   EE  +L      K  
Sbjct: 86  NYVARNKPKTV------IYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAA 139
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.68
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.65
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.63
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.61
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.6
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.59
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.57
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.57
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.56
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.54
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.54
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.54
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.48
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.48
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.43
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.41
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.4
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.35
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.27
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.26
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.23
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.19
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.11
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.07
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 99.04
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 99.03
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 98.99
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 98.8
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 98.8
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 98.48
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: AP6A hydrolase Ndx1
species: Thermus thermophilus [TaxId: 274]

Probab=99.68  E-value=1.6e-16  Score=125.88  Aligned_cols=102  Identities=21%  Similarity=0.316  Sum_probs=75.7

Q ss_pred             cEEEEEEecCCCCCceecCCeecCCCCCHHHHHHHHHHHHhCCceEEEEecccceEEEEeeCCccccccccccceEEEEE
Q psy169          158 HLVLLIKEKLGDKSHWIMPFGKRQEGETMRQTAERILAEKFNKTIHARFYGNAPCGFYKFKYPKSLQAESNVVGAKLFFF  237 (280)
Q Consensus       158 ~LyLLVk~~~g~~~~W~FP~G~ve~gEtl~qaAeRel~Ee~G~~i~v~~vg~~P~g~~~~~yp~~~~~~~~~~g~kvfff  237 (280)
                      ..+||++++   .|.|.||||+++.|||+.+||.||++||+|+++...    .+++.+.|.++..       ....++||
T Consensus        14 ~~vLl~~~~---~g~w~~PgG~ve~gEt~~~aa~RE~~EEtGi~~~~~----~~~~~~~~~~~~~-------~~~~~~~~   79 (126)
T d1vcda1          14 REVLLLRDR---MGFWVFPKGHPEPGESLEEAAVREVWEETGVRAEVL----LPLYPTRYVNPKG-------VEREVHWF   79 (126)
T ss_dssp             SCEEEEECT---TSCEECCEECCCTTCCHHHHHHHHHHHHHCCEEEEE----EEEEEEEEECTTS-------CEEEEEEE
T ss_pred             CEEEEEEcC---CCCEECCccccCCCCCHHHHHHHHHHHHcCCeeEEE----EEEeeeeeccCCC-------eEEEEEEE
Confidence            348888876   358999999999999999999999999999987642    3455666665543       23467788


Q ss_pred             EEEEeCCCC-CCCccceEeecccccccccc-HHHHHHH
Q psy169          238 KAQYLEGDV-KDKKLEYTWAAREELPKLLL-EDYNKNI  273 (280)
Q Consensus       238 ka~~~~G~~-~~e~~d~~WltkeEl~~~l~-~~y~~~v  273 (280)
                      .+....+.. ..++.+++|++.+|+.+++. |....-|
T Consensus        80 ~~~~~~~~~~~~e~~~~~W~~~~e~~~~~~~~~~~~il  117 (126)
T d1vcda1          80 LMRGEGAPRLEEGMTGAGWFSPEEARALLAFPEDLGLL  117 (126)
T ss_dssp             EEEEESCCCCCTTCCEEEEECHHHHHHHBCSHHHHHHH
T ss_pred             EEEEcCCCCCCccceEEEEEEHHHHhhccCChHHHHHH
Confidence            887754332 35678999999999999764 4433333
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure