Diaphorina citri psyllid: psy17007


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MAAYLSYPSPYLHKSDSFYITPQGLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQLFYVI
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccc
*************************************************TVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELG*******************************STPERVELATALQLSETQLFYV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAYLSYPSPYLHKSDSFYITPQGLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQLFYVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Brain-specific homeobox protein homolog DNA binding protein that function as transcriptional activator. Is essentiel for normal postnatal growth and nursing. Is an essential factor for neuronal neuropeptide Y and agouti-related peptide function and locomotory behavior in the control of energy balance.confidentQ810B3
Brain-specific homeobox protein homolog DNA binding protein that function as transcriptional activator (By similarity). May play a role in the determination and function of cell types in the brain.confidentQ6R3Q6
Brain-specific homeobox protein homolog DNA binding protein that function as transcriptional activator. Is essentiel for normal postnatal growth and nursing. Is an essential factor for neuronal neuropeptide Y and agouti-related peptide function and locomotory behavior in the control of energy balance.confidentQ3C1V8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007626 [BP]locomotory behaviorprobableGO:0044708, GO:0050896, GO:0008150, GO:0007610
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0070491 [MF]repressing transcription factor bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0003002 [BP]regionalizationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0008301 [MF]DNA binding, bendingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0034504 [BP]protein localization to nucleusprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0048729 [BP]tissue morphogenesisprobableGO:0032502, GO:0048856, GO:0009888, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0008190 [MF]eukaryotic initiation factor 4E bindingprobableGO:0031369, GO:0003674, GO:0005488, GO:0005515
GO:0000982 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0071103 [BP]DNA conformation changeprobableGO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0060429 [BP]epithelium developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0060056 [BP]mammary gland involutionprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0048771, GO:0007275, GO:0044767, GO:0060443, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0030879, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0006406 [BP]mRNA export from nucleusprobableGO:0015931, GO:0051169, GO:0051168, GO:0016482, GO:0051028, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0006405, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0008150
GO:0042755 [BP]eating behaviorprobableGO:0007631, GO:0050896, GO:0008150, GO:0007610
GO:0032993 [CC]protein-DNA complexprobableGO:0005575, GO:0032991

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B72, chain A
Confidence level:very confident
Coverage over the Query: 87-95,120-163
View the alignment between query and template
View the model in PyMOL
Template: 2DMT, chain A
Confidence level:very confident
Coverage over the Query: 39-106
View the alignment between query and template
View the model in PyMOL