Psyllid ID: psy17007


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MAAYLSYPSPYLHKSDSFYITPQGLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQLFYVI
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHEEEc
maaylsypspylhksdsfyitpqglpfgslfstsphelgskhcrrrkartvfsdhqltGLEKRFEAQRYLSTPERVELATALQLSETQVKTWfqnrlpfgslfstsphelgskhcrrrkartvfsdhqltGLEKRFEAQRYLSTPERVELATALQLSETQLFYVI
maaylsypspylHKSDSFYITPQGLPFGSLFSTSPHELGSKHCRRRKARtvfsdhqltglekRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELGSKHCRRRKARtvfsdhqltglekRFEAQRYLSTPERVELAtalqlsetqlfyvi
MAAYLSYPSPYLHKSDSFYITPQGLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQLFYVI
**********YLHKSDSFYITPQGLPFGSLF******************TVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFS*****************TVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQLFY**
****************************************************SDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELG*******************************************QLSETQLFYV*
MAAYLSYPSPYLHKSDSFYITPQGLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQLFYVI
************************************************RTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFS**************************************STPERVELATALQLSETQLFYVI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAYLSYPSPYLHKSDSFYITPQGLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQLFYVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
Q6RFL5233 Brain-specific homeobox p yes N/A 0.575 0.407 0.653 7e-29
Q3C1V8233 Brain-specific homeobox p yes N/A 0.563 0.399 0.66 2e-28
Q810B3232 Brain-specific homeobox p yes N/A 0.515 0.366 0.719 2e-28
Q6R3Q6227 Brain-specific homeobox p yes N/A 0.436 0.317 0.794 1e-25
Q04787429 Brain-specific homeobox p yes N/A 0.339 0.130 0.910 3e-24
Q9HBU1254 Homeobox protein BarH-lik no N/A 0.678 0.440 0.420 6e-18
Q9ER42254 Homeobox protein BarH-lik no N/A 0.678 0.440 0.420 5e-17
Q9W6D8207 Homeobox protein BarH-lik no N/A 0.678 0.541 0.420 9e-17
Q9DED6247 Homeobox protein BarH-lik no N/A 0.690 0.461 0.424 2e-16
Q503F2248 Homeobox protein BarH-lik no N/A 0.575 0.383 0.449 5e-15
>sp|Q6RFL5|BSH_CHICK Brain-specific homeobox protein homolog OS=Gallus gallus GN=BSX PE=2 SV=1 Back     alignment and function desciption
 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 74/101 (73%), Gaps = 6/101 (5%)

Query: 2   AAYLSYPSPYLHKSD-----SFYITPQGLPFGSLFSTSPH-ELGSKHCRRRKARTVFSDH 55
           A    +P P LHK +      +++T  G+P  +LF    H EL  KHCRRRKARTVFSD 
Sbjct: 63  ALLAPHPHPALHKPEHHHHHPYFLTTSGVPVPALFPHHAHAELPGKHCRRRKARTVFSDS 122

Query: 56  QLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNR 96
           QL+GLEKRFE QRYLSTPERVELATAL LSETQVKTWFQNR
Sbjct: 123 QLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNR 163




DNA binding protein that function as transcriptional activator (By similarity). May play a role in the determination and function of cell types in the brain.
Gallus gallus (taxid: 9031)
>sp|Q3C1V8|BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens GN=BSX PE=2 SV=2 Back     alignment and function description
>sp|Q810B3|BSH_MOUSE Brain-specific homeobox protein homolog OS=Mus musculus GN=Bsx PE=1 SV=1 Back     alignment and function description
>sp|Q6R3Q6|BSH_DANRE Brain-specific homeobox protein homolog OS=Danio rerio GN=bsx PE=2 SV=1 Back     alignment and function description
>sp|Q04787|BSH_DROME Brain-specific homeobox protein OS=Drosophila melanogaster GN=bsh PE=2 SV=5 Back     alignment and function description
>sp|Q9HBU1|BARX1_HUMAN Homeobox protein BarH-like 1 OS=Homo sapiens GN=BARX1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ER42|BARX1_MOUSE Homeobox protein BarH-like 1 OS=Mus musculus GN=Barx1 PE=2 SV=1 Back     alignment and function description
>sp|Q9W6D8|BARX1_CHICK Homeobox protein BarH-like 1 (Fragment) OS=Gallus gallus GN=BARX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DED6|BAX1B_CHICK Homeobox protein BarH-like 1b OS=Gallus gallus GN=BARX1B PE=2 SV=1 Back     alignment and function description
>sp|Q503F2|BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio GN=barx1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
193636579 286 PREDICTED: brain-specific homeobox prote 0.575 0.332 0.686 7e-32
242023322 342 brain-specific homeobox protein, putativ 0.509 0.245 0.767 1e-30
431842059232 Brain-specific homeobox protein like pro 0.515 0.366 0.730 8e-28
126326512233 PREDICTED: brain-specific homeobox prote 0.515 0.364 0.719 1e-27
395520088233 PREDICTED: brain-specific homeobox prote 0.515 0.364 0.719 2e-27
45383147233 brain-specific homeobox protein homolog 0.575 0.407 0.653 3e-27
296216447232 PREDICTED: brain-specific homeobox prote 0.515 0.366 0.719 8e-27
426370818232 PREDICTED: brain-specific homeobox prote 0.515 0.366 0.719 9e-27
403262508232 PREDICTED: brain-specific homeobox prote 0.563 0.400 0.66 9e-27
332838046233 PREDICTED: brain-specific homeobox prote 0.563 0.399 0.66 9e-27
>gi|193636579|ref|XP_001943337.1| PREDICTED: brain-specific homeobox protein homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 83/102 (81%), Gaps = 7/102 (6%)

Query: 2   AAYLSYPSPYLHKS---DSFYITPQGLPFGSLFSTSPH----ELGSKHCRRRKARTVFSD 54
           +AYLSYP+ Y+HK+   + F+I+PQG+PFGS++         +L S+ CRRRKARTVFSD
Sbjct: 63  SAYLSYPAHYMHKNSITEPFFISPQGVPFGSIWGARSDYGHGQLSSRLCRRRKARTVFSD 122

Query: 55  HQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNR 96
            QLTGLEKRFE QRYLSTPERVELAT L+LSETQVKTWFQNR
Sbjct: 123 QQLTGLEKRFEVQRYLSTPERVELATELRLSETQVKTWFQNR 164




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242023322|ref|XP_002432083.1| brain-specific homeobox protein, putative [Pediculus humanus corporis] gi|212517457|gb|EEB19345.1| brain-specific homeobox protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|431842059|gb|ELK01408.1| Brain-specific homeobox protein like protein [Pteropus alecto] Back     alignment and taxonomy information
>gi|126326512|ref|XP_001370233.1| PREDICTED: brain-specific homeobox protein homolog [Monodelphis domestica] Back     alignment and taxonomy information
>gi|395520088|ref|XP_003764170.1| PREDICTED: brain-specific homeobox protein homolog [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|45383147|ref|NP_989843.1| brain-specific homeobox protein homolog [Gallus gallus] gi|51701277|sp|Q6RFL5.1|BSH_CHICK RecName: Full=Brain-specific homeobox protein homolog gi|40737191|gb|AAR89086.1| brain-specific homeodomain protein [Gallus gallus] Back     alignment and taxonomy information
>gi|296216447|ref|XP_002754567.1| PREDICTED: brain-specific homeobox protein homolog [Callithrix jacchus] Back     alignment and taxonomy information
>gi|426370818|ref|XP_004052355.1| PREDICTED: brain-specific homeobox protein homolog [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|403262508|ref|XP_003923628.1| PREDICTED: brain-specific homeobox protein homolog [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|332838046|ref|XP_522208.3| PREDICTED: brain-specific homeobox protein homolog [Pan troglodytes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
UNIPROTKB|E2R0R6232 BSX "Uncharacterized protein" 0.539 0.383 0.694 2.4e-28
UNIPROTKB|Q6RFL5233 BSX "Brain-specific homeobox p 0.545 0.386 0.677 3.1e-28
UNIPROTKB|E1BAF5232 BSX "Uncharacterized protein" 0.539 0.383 0.694 3.1e-28
UNIPROTKB|F1S9Q4232 BSX "Uncharacterized protein" 0.539 0.383 0.694 3.1e-28
UNIPROTKB|Q3C1V8233 BSX "Brain-specific homeobox p 0.563 0.399 0.66 5e-28
MGI|MGI:2669849232 Bsx "brain specific homeobox" 0.515 0.366 0.719 6.4e-28
RGD|1565120232 Bsx "brain specific homeobox" 0.515 0.366 0.696 5.7e-27
ZFIN|ZDB-GENE-040628-4245 bsx "brain specific homeobox" 0.533 0.359 0.695 1.2e-26
FB|FBgn0000529429 bsh "brain-specific homeobox" 0.557 0.214 0.613 9.8e-23
WB|WBGene00006380197 tab-1 [Caenorhabditis elegans 0.327 0.274 0.851 2.7e-20
UNIPROTKB|E2R0R6 BSX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
 Identities = 66/95 (69%), Positives = 73/95 (76%)

Query:     8 PSPY--LHKSDS---FYITPQGLPFGSLFSTSPH-ELGSKHCRRRKARTVFSDHQLTGLE 61
             P P+  LHK D    +++T  G+P  +LF    H EL  KHCRRRKARTVFSD QL+GLE
Sbjct:    67 PHPHHPLHKGDHHHPYFLTTSGMPVPALFPHPQHSELPGKHCRRRKARTVFSDSQLSGLE 126

Query:    62 KRFEAQRYLSTPERVELATALQLSETQVKTWFQNR 96
             KRFE QRYLSTPERVELATAL LSETQVKTWFQNR
Sbjct:   127 KRFEIQRYLSTPERVELATALSLSETQVKTWFQNR 161


GO:0060056 "mammary gland involution" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0042755 "eating behavior" evidence=IEA
GO:0007626 "locomotory behavior" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005667 "transcription factor complex" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
UNIPROTKB|Q6RFL5 BSX "Brain-specific homeobox protein homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAF5 BSX "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9Q4 BSX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3C1V8 BSX "Brain-specific homeobox protein homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2669849 Bsx "brain specific homeobox" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565120 Bsx "brain specific homeobox" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040628-4 bsx "brain specific homeobox" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0000529 bsh "brain-specific homeobox" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006380 tab-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6RFL5BSH_CHICKNo assigned EC number0.65340.57570.4077yesN/A
Q810B3BSH_MOUSENo assigned EC number0.71910.51510.3663yesN/A
Q3C1V8BSH_HUMANNo assigned EC number0.660.56360.3991yesN/A
Q6R3Q6BSH_DANRENo assigned EC number0.79450.43630.3171yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-20
smart0038957 smart00389, HOX, Homeodomain 1e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-16
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-12
smart0038957 smart00389, HOX, Homeodomain 6e-10
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 4e-09
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-07
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 79.1 bits (196), Expect = 2e-20
 Identities = 30/51 (58%), Positives = 33/51 (64%)

Query: 46 RKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNR 96
          R+ RT F+  QL  LEK FE  RY S  ER ELA  L L+E QVK WFQNR
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNR 51


Length = 57

>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
KOG2251|consensus228 99.75
KOG0488|consensus309 99.75
KOG0484|consensus125 99.73
KOG0487|consensus308 99.73
KOG0843|consensus197 99.72
KOG0842|consensus307 99.71
KOG0850|consensus245 99.7
KOG0489|consensus261 99.7
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.67
KOG0490|consensus235 99.66
KOG0492|consensus246 99.66
KOG0494|consensus332 99.66
KOG0848|consensus317 99.65
KOG0485|consensus268 99.63
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.63
KOG3802|consensus398 99.61
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.58
KOG0493|consensus342 99.56
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.55
KOG0844|consensus 408 99.48
KOG0491|consensus194 99.47
KOG0483|consensus198 99.47
KOG4577|consensus383 99.46
KOG0486|consensus 351 99.45
COG5576156 Homeodomain-containing transcription factor [Trans 99.43
KOG0847|consensus288 99.37
KOG1168|consensus385 99.16
KOG0849|consensus354 99.11
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.97
KOG0488|consensus309 98.92
KOG0775|consensus304 98.9
KOG0484|consensus125 98.81
KOG0489|consensus261 98.78
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.74
KOG0843|consensus197 98.72
KOG2251|consensus 228 98.72
KOG0487|consensus308 98.72
KOG0848|consensus317 98.69
KOG0842|consensus 307 98.69
KOG0850|consensus245 98.68
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.59
KOG0774|consensus334 98.59
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.57
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.51
KOG2252|consensus558 98.46
KOG0492|consensus246 98.45
KOG0493|consensus342 98.43
KOG0491|consensus194 98.36
KOG0485|consensus 268 98.34
KOG0494|consensus 332 98.25
KOG0490|consensus235 97.95
KOG1146|consensus 1406 97.83
KOG0849|consensus 354 97.73
KOG0486|consensus 351 97.73
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.68
KOG0844|consensus 408 97.65
COG5576156 Homeodomain-containing transcription factor [Trans 97.5
KOG0483|consensus198 97.46
KOG3623|consensus 1007 96.96
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 96.96
KOG3802|consensus398 96.8
KOG0847|consensus288 96.71
KOG0773|consensus342 96.69
KOG4577|consensus 383 96.22
KOG2252|consensus558 96.1
KOG0774|consensus334 96.0
KOG0775|consensus304 95.09
KOG1146|consensus 1406 94.97
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.58
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 92.38
COG3413215 Predicted DNA binding protein [General function pr 85.17
KOG1168|consensus385 84.98
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 84.84
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 84.27
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 84.24
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 83.31
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 81.19
cd0110468 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain 80.93
cd0476368 HTH_MlrA-like Helix-Turn-Helix DNA binding domain 80.77
>KOG2251|consensus Back     alignment and domain information
Probab=99.75  E-value=3.7e-18  Score=125.75  Aligned_cols=68  Identities=34%  Similarity=0.459  Sum_probs=63.5

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhccchhhhhhhhccCCCCccccCCC
Q psy17007         39 GSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTS  106 (165)
Q Consensus        39 ~~~~~~~rr~R~~~s~~q~~~Le~~f~~~~~p~~~~~~~la~~l~l~~~~V~~WF~nrr~~~~~~~~~  106 (165)
                      ....+|.||.||+|+..|+++||.+|.++.||++..+++||.+|+|.+.+|+|||.|||+|+++....
T Consensus        31 ~~~pRkqRRERTtFtr~QlevLe~LF~kTqYPDv~~rEelAlklnLpeSrVqVWFKNRRAK~r~qq~q   98 (228)
T KOG2251|consen   31 SSGPRKQRRERTTFTRKQLEVLEALFAKTQYPDVFMREELALKLNLPESRVQVWFKNRRAKCRRQQQQ   98 (228)
T ss_pred             CccchhcccccceecHHHHHHHHHHHHhhcCccHHHHHHHHHHhCCchhhhhhhhccccchhhHhhhh
Confidence            36778999999999999999999999999999999999999999999999999999999999876543



>KOG0488|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA Back     alignment and domain information
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 3e-16
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 3e-11
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 2e-12
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 2e-07
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 4e-12
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 2e-07
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 3e-11
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 6e-06
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 2e-10
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 4e-06
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 3e-10
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 9e-05
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 5e-10
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 3e-05
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 7e-10
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 6e-05
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 9e-10
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 5e-05
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 1e-09
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 2e-05
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 1e-09
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 9e-05
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 4e-09
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 7e-05
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 6e-09
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 7e-09
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 4e-04
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 1e-08
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 9e-04
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 3e-08
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 3e-08
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 8e-08
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 1e-07
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 1e-07
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-07
1hom_A68 Determination Of The Three-Dimensional Structure Of 2e-07
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 3e-07
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 1e-06
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-06
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 1e-06
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-06
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-06
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-06
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 2e-06
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 2e-06
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 3e-06
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 4e-06
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 4e-06
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 5e-06
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 5e-06
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 6e-06
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 7e-06
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 2e-05
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 4e-05
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 2e-04
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 2e-04
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-04
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 3e-04
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 6e-04
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 6e-04
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 7e-04
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 8e-04
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure

Iteration: 1

Score = 81.3 bits (199), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 37/60 (61%), Positives = 50/60 (83%) Query: 37 ELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNR 96 E G+K + R++RTVF++ QL GLEKRFE Q+YLSTP+R++LA +L LS+ QVKTW+QNR Sbjct: 9 EPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNR 68
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 4e-28
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-19
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-27
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 4e-19
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 5e-27
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-18
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 6e-27
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 6e-19
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 9e-27
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-18
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-26
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-18
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-26
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 4e-18
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-26
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 6e-18
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 6e-26
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-17
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 6e-26
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 7e-18
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-25
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-17
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 4e-24
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-15
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-20
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-13
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 6e-20
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-11
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 3e-18
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 8e-11
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 4e-18
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 7e-11
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-17
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 2e-10
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-17
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-10
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 2e-16
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 2e-09
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 5e-16
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 7e-09
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 6e-16
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 6e-09
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 7e-16
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 7e-09
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-15
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-09
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-15
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-08
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 8e-15
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 7e-08
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 8e-15
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-08
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-14
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-14
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-07
2xsd_C164 POU domain, class 3, transcription factor 1; trans 6e-14
2xsd_C164 POU domain, class 3, transcription factor 1; trans 7e-07
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-13
3d1n_I151 POU domain, class 6, transcription factor 1; prote 9e-07
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-12
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-05
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-12
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 7e-12
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 6e-07
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-05
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-11
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-05
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-11
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-05
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-11
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-05
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 6e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-04
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-10
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 6e-04
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-10
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-04
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-10
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-05
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 5e-04
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-10
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-04
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 5e-10
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 4e-04
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 6e-10
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-04
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-10
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-04
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 3e-09
1uhs_A72 HOP, homeodomain only protein; structural genomics 7e-09
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-08
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-07
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-05
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-07
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 5e-07
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 7e-07
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 7e-07
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 4e-05
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 98.7 bits (246), Expect = 4e-28
 Identities = 38/65 (58%), Positives = 52/65 (80%)

Query: 32 STSPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKT 91
           +S  E G+K  + R++RTVF++ QL GLEKRFE Q+YLSTP+R++LA +L LS+ QVKT
Sbjct: 4  GSSGGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKT 63

Query: 92 WFQNR 96
          W+QNR
Sbjct: 64 WYQNR 68


>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.84
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.84
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.83
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.83
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.82
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.82
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.82
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.82
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.81
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.81
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.81
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.8
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.79
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.79
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.79
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.79
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.79
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.79
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.79
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.79
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.79
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.79
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.78
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.78
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.78
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.78
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.78
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.77
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.77
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.77
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.77
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.77
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.77
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.77
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.77
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.77
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.76
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.76
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.76
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.75
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.75
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.75
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.75
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.75
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.75
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.75
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.74
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.73
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.72
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.72
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.72
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.71
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.71
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.71
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.71
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.71
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.7
2e19_A64 Transcription factor 8; homeobox domain, structura 99.7
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.7
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.7
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.7
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.69
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.69
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.69
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.69
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.69
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.68
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.66
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.65
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.57
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.56
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.55
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.52
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.39
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.37
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.29
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.12
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.11
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.1
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.1
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.09
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.09
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.08
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.08
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.08
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.07
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.07
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.05
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.05
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.04
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.04
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.04
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.04
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.04
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.04
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.03
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.03
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.03
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.02
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.02
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.01
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.0
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 98.99
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 98.98
3a02_A60 Homeobox protein aristaless; homeodomain, developm 98.97
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 98.97
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 98.96
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 98.96
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 98.96
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 98.95
3a01_A93 Homeodomain-containing protein; homeodomain, prote 98.94
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 98.94
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 98.94
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 98.93
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 98.93
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 98.93
1uhs_A72 HOP, homeodomain only protein; structural genomics 98.91
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 98.9
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 98.9
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 98.89
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 98.86
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 98.86
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 98.83
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 98.83
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 98.81
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 98.81
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 98.78
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 98.76
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 98.76
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 98.74
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 98.73
2e19_A64 Transcription factor 8; homeobox domain, structura 98.73
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 98.72
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 98.72
1lfb_A99 Liver transcription factor (LFB1); transcription r 98.7
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 98.65
3d1n_I151 POU domain, class 6, transcription factor 1; prote 98.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.65
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 98.62
1e3o_C160 Octamer-binding transcription factor 1; transcript 98.61
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 98.6
2xsd_C164 POU domain, class 3, transcription factor 1; trans 98.6
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.58
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 98.55
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.43
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.42
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.31
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.3
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.11
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 97.84
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 97.82
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.91
1u78_A141 TC3 transposase, transposable element TC3 transpos 88.02
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 85.77
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 85.71
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 85.54
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 82.32
2k27_A159 Paired box protein PAX-8; paired domain, solution 80.96
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.84  E-value=3.6e-21  Score=122.89  Aligned_cols=68  Identities=54%  Similarity=0.805  Sum_probs=62.2

Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhccchhhhhhhhccCCCCccccCCC
Q psy17007         39 GSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSLFSTS  106 (165)
Q Consensus        39 ~~~~~~~rr~R~~~s~~q~~~Le~~f~~~~~p~~~~~~~la~~l~l~~~~V~~WF~nrr~~~~~~~~~  106 (165)
                      +...++.++.|+.|+.+|+.+||..|..++||+..+++.||..+||++.+|++||+|||++.++...+
T Consensus        11 ~~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk~~~s   78 (80)
T 2dmt_A           11 GTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGPS   78 (80)
T ss_dssp             CCCCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSCCCSC
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhcccCC
Confidence            34566788999999999999999999999999999999999999999999999999999999876543



>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-18
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-11
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 8e-17
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 6e-10
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-16
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-09
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-16
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-09
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-08
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 4e-15
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 8e-08
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 8e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 7e-08
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-15
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-07
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-14
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-07
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-14
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 4e-08
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-14
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-07
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 9e-14
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-08
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-13
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-06
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 3e-13
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 4e-07
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 4e-13
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-06
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-13
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-07
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-07
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 7e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 3e-06
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-12
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 8e-06
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-12
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-07
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-12
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-05
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-12
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-05
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 7e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-05
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-11
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-05
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 4e-07
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-11
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 9e-06
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 9e-11
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6e-04
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-05
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-05
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-05
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 73.3 bits (180), Expect = 1e-18
 Identities = 26/63 (41%), Positives = 32/63 (50%)

Query: 34 SPHELGSKHCRRRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWF 93
          +P          RK R  ++ HQ   LEK F    YL+   R E+A  L L+E QVK WF
Sbjct: 2  NPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWF 61

Query: 94 QNR 96
          QNR
Sbjct: 62 QNR 64


>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.87
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.87
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.85
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.85
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.84
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.84
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.84
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.84
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.82
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.82
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.82
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.81
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.81
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.81
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.81
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.81
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.81
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.8
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.8
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.79
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.79
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.77
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.77
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.76
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.71
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.69
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.69
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.66
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.64
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.63
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.63
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.26
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.25
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.22
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.21
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.21
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.19
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.19
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.18
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.18
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.13
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.13
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.13
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.11
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.09
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.09
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.06
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.04
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.04
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.03
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.02
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.01
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 98.98
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 98.92
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 98.86
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.75
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.74
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.62
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.56
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.51
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.51
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.5
d1hlva166 DNA-binding domain of centromere binding protein B 91.21
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 87.64
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=4.3e-23  Score=121.90  Aligned_cols=58  Identities=34%  Similarity=0.572  Sum_probs=55.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhccchhhhhhhhccCCCCccc
Q psy17007         45 RRKARTVFSDHQLTGLEKRFEAQRYLSTPERVELATALQLSETQVKTWFQNRLPFGSL  102 (165)
Q Consensus        45 ~rr~R~~~s~~q~~~Le~~f~~~~~p~~~~~~~la~~l~l~~~~V~~WF~nrr~~~~~  102 (165)
                      +++.|++||.+|+.+||..|..++||+..+++.||..+||++.+|++||||||++.++
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            4678999999999999999999999999999999999999999999999999998863



>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure