Diaphorina citri psyllid: psy17011


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MTSTEQSGTTKSWELSMYELNRTPQEAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQVRVLEKLNKSHSQAALVQSINEGIKLQSQHRLQRTKKNIQGNEENTPDISNTDQTSVQQQPSPQPTTSNAIKNQLSPAVPKSPEARPSSAASSSTTKVSKKTAKSDVMTSELETDDTSETDDKISTVESATDGEVDHLTKYLTMRLRLEGSDICDSNFGIYVSPSSNNFILLPGNQSLRQIHDKYWKSEKPLEVYYSWKKV
ccccccccccccccccHHHccccccccccccccEEEcccccccccccccccccccccEEccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHcccccccccccEEEEEcccccEEEccccccccccccccccccccEEEEEccccc
*********************************IAV**RSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQVRVL**********************************************************************************************************************************VDHLTKYLTMRLRLEGSDICDSNFGIYVSPSSNNFILLPGNQSLRQIHDKYWKSEKPLEVYYSWKKV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSTEQSGTTKSWELSMYELNRTPQEAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQVRVLEKLNKSHSQAALVQSINEGIKLQSQHRLQRTKKNIQGNEENTPDISNTDQTSVQQQPSPQPTTSNAIKNQLSPAVPKSPEARPSSAASSSTTKVSKKTAKSDVMTSELETDDTSETDDKISTVESATDGEVDHLTKYLTMRLRLEGSDICDSNFGIYVSPSSNNFILLPGNQSLRQIHDKYWKSEKPLEVYYSWKKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase RING2 E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.very confidentQ803I4
E3 ubiquitin-protein ligase RING2 E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4. Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity.very confidentQ5R9J5
E3 ubiquitin-protein ligase RING2 E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4. Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity.confidentQ4KLY4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044427 [CC]chromosomal partconfidentGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226, GO:0044422
GO:0005488 [MF]bindingconfidentGO:0003674
GO:0004842 [MF]ubiquitin-protein ligase activityconfidentGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0044763 [BP]single-organism cellular processconfidentGO:0009987, GO:0008150, GO:0044699
GO:0043234 [CC]protein complexconfidentGO:0005575, GO:0032991
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044451 [CC]nucleoplasm partconfidentGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0035518 [BP]histone H2A monoubiquitinationprobableGO:0010390, GO:0044699, GO:0044267, GO:0033522, GO:0044260, GO:0016574, GO:0006325, GO:0071840, GO:0070647, GO:0016043, GO:0032446, GO:0016570, GO:0009987, GO:0006464, GO:0071704, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006513, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0008150, GO:0016568, GO:0016569
GO:0071339 [CC]MLL1 complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422, GO:0044665
GO:0000151 [CC]ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0001739 [CC]sex chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0000803, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0005720, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0045498 [BP]sex comb developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0035102 [CC]PRC1 complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0031519, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006342 [BP]chromatin silencingprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0008278 [CC]cohesin complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0009948 [BP]anterior/posterior axis specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0008150, GO:0003002, GO:0009798, GO:0007275, GO:0044699
GO:0030708 [BP]germarium-derived female germ-line cyst encapsulationprobableGO:0016333, GO:0048610, GO:0060429, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0007293, GO:0009653, GO:0044699, GO:0002009, GO:0000003, GO:0048869, GO:0030707, GO:0007276, GO:0048729, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0009888, GO:0044767, GO:0022414, GO:0048138, GO:0048139, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0044763
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0048593 [BP]camera-type eye morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048592, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0009653, GO:0043010, GO:0007275, GO:0044699
GO:0030713 [BP]ovarian follicle cell stalk formationprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0009653, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0030707, GO:0016043, GO:0032989, GO:0007276, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0000003, GO:0044702, GO:0003006, GO:0048856, GO:0044763
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0071535 [MF]RING-like zinc finger domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0001702 [BP]gastrulation with mouth forming secondprobableGO:0048598, GO:0032502, GO:0048856, GO:0044707, GO:0007369, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0007062 [BP]sister chromatid cohesionprobableGO:0006996, GO:0051276, GO:0022402, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0044699, GO:0071840, GO:0007059, GO:0007049
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0033339 [BP]pectoral fin developmentprobableGO:0032502, GO:0033333, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0044699, GO:0007275, GO:0048736

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CKL, chain B
Confidence level:very confident
Coverage over the Query: 11-110
View the alignment between query and template
View the model in PyMOL
Template: 3GS2, chain A
Confidence level:very confident
Coverage over the Query: 237-320
View the alignment between query and template
View the model in PyMOL