Psyllid ID: psy17011
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 321 | 2.2.26 [Sep-21-2011] | |||||||
| Q66J69 | 344 | E3 ubiquitin-protein liga | N/A | N/A | 0.931 | 0.869 | 0.492 | 2e-83 | |
| Q5R9J5 | 336 | E3 ubiquitin-protein liga | yes | N/A | 0.928 | 0.886 | 0.510 | 2e-82 | |
| Q99496 | 336 | E3 ubiquitin-protein liga | yes | N/A | 0.925 | 0.883 | 0.5 | 3e-82 | |
| Q9CQJ4 | 336 | E3 ubiquitin-protein liga | yes | N/A | 0.925 | 0.883 | 0.5 | 3e-82 | |
| Q803I4 | 336 | E3 ubiquitin-protein liga | yes | N/A | 0.965 | 0.922 | 0.504 | 5e-82 | |
| Q7ZWM8 | 343 | E3 ubiquitin-protein liga | N/A | N/A | 0.928 | 0.868 | 0.486 | 7e-81 | |
| O35730 | 406 | E3 ubiquitin-protein liga | no | N/A | 0.953 | 0.753 | 0.401 | 5e-74 | |
| Q4KLY4 | 308 | E3 ubiquitin-protein liga | yes | N/A | 0.775 | 0.808 | 0.548 | 3e-73 | |
| Q06587 | 406 | E3 ubiquitin-protein liga | no | N/A | 0.482 | 0.381 | 0.764 | 6e-70 | |
| Q6MGB6 | 406 | E3 ubiquitin-protein liga | no | N/A | 0.345 | 0.273 | 0.757 | 1e-69 |
| >sp|Q66J69|RNG2A_XENLA E3 ubiquitin-protein ligase RING2-A OS=Xenopus laevis GN=rnf2-a PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 309 bits (791), Expect = 2e-83, Method: Compositional matrix adjust.
Identities = 167/339 (49%), Positives = 213/339 (62%), Gaps = 40/339 (11%)
Query: 9 TTKSWELSMYELNRTPQEAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFC 68
++K+WELS+YEL+RTPQEAI D TEIAVSPRSLHSELMCPICLDMLK TMTTKECLHRFC
Sbjct: 10 SSKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFC 69
Query: 69 SDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQVRVLEKLN 128
SDCI+TALRSGNKECPTCRKKLVSKRSLR DPNFD LISKIYPSRDEYEAHQ RVL KLN
Sbjct: 70 SDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQDRVLAKLN 129
Query: 129 KSHSQAALVQSINEGIKLQSQHRLQRTKKN--------IQGNEENTPDISNTDQTSVQQQ 180
+ H+Q AL SI EG+K+Q+ HR QR +K+ G E+N S+ SV
Sbjct: 130 RLHNQQALSSSIEEGLKMQAMHRAQRVRKHQHESDNTTFSGGEDNCDSRSHVSNPSVHSN 189
Query: 181 PSPQPTTSNAIKNQLSPAVP--------KSPEARPSSAASSSTTKVSKKTAKSDVMTSEL 232
P+ + ++ S A P +SP+ P + S ++ + V
Sbjct: 190 QEAGPSRKRSRASEDSGAEPDLSHEGGVRSPDP-PGGGETGSEIELVFRAHPLLV----- 243
Query: 233 ETDDTSETDDKISTVESATDGEVDHLTKYLTMRLRLEG------------SDICDSNFGI 280
E D S+T V++ + VDHL+KYL +R+ LE ++ + + I
Sbjct: 244 EKDGYSQT----RYVKTTANATVDHLSKYLALRIALEEEVLRGEAEGVTLGEVSEKQYTI 299
Query: 281 YV--SPSSNNFILLPGNQSLRQIHDKYWKSEKPLEVYYS 317
Y+ + + L G+ +L +++KYWK KPLE+YY+
Sbjct: 300 YICTGVAGGQYTTLNGSLTLELVNEKYWKVSKPLELYYA 338
|
E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. Xenopus laevis (taxid: 8355) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q5R9J5|RING2_PONAB E3 ubiquitin-protein ligase RING2 OS=Pongo abelii GN=RNF2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens GN=RNF2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9CQJ4|RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus GN=Rnf2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q803I4|RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio GN=rnf2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7ZWM8|RNG2B_XENLA E3 ubiquitin-protein ligase RING2-B OS=Xenopus laevis GN=rnf2-b PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O35730|RING1_MOUSE E3 ubiquitin-protein ligase RING1 OS=Mus musculus GN=Ring1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q4KLY4|RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus GN=Rnf2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q06587|RING1_HUMAN E3 ubiquitin-protein ligase RING1 OS=Homo sapiens GN=RING1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q6MGB6|RING1_RAT E3 ubiquitin-protein ligase RING1 OS=Rattus norvegicus GN=Ring1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 321 | ||||||
| 383865665 | 368 | PREDICTED: E3 ubiquitin-protein ligase R | 0.996 | 0.869 | 0.536 | 1e-100 | |
| 307174595 | 379 | E3 ubiquitin-protein ligase RING2 [Campo | 0.996 | 0.844 | 0.526 | 1e-99 | |
| 332021896 | 379 | E3 ubiquitin-protein ligase RING2 [Acrom | 0.996 | 0.844 | 0.523 | 7e-99 | |
| 322796367 | 379 | hypothetical protein SINV_06659 [Solenop | 0.996 | 0.844 | 0.523 | 7e-99 | |
| 340724527 | 380 | PREDICTED: e3 ubiquitin-protein ligase R | 0.996 | 0.842 | 0.525 | 1e-98 | |
| 66523966 | 403 | PREDICTED: e3 ubiquitin-protein ligase R | 0.996 | 0.794 | 0.525 | 2e-98 | |
| 193643594 | 335 | PREDICTED: e3 ubiquitin-protein ligase R | 0.978 | 0.937 | 0.579 | 2e-98 | |
| 380021050 | 369 | PREDICTED: E3 ubiquitin-protein ligase R | 0.987 | 0.859 | 0.530 | 2e-98 | |
| 242019424 | 352 | ubiquitin ligase protein RING2-A, putati | 0.978 | 0.892 | 0.570 | 3e-98 | |
| 350425025 | 380 | PREDICTED: E3 ubiquitin-protein ligase R | 0.996 | 0.842 | 0.522 | 8e-98 |
| >gi|383865665|ref|XP_003708293.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 372 bits (955), Expect = e-100, Method: Compositional matrix adjust.
Identities = 197/367 (53%), Positives = 250/367 (68%), Gaps = 47/367 (12%)
Query: 1 MTSTEQSGTTKSWELSMYELNRTPQEAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTT 60
M STEQ G K+WELS+YEL+RTPQ+AITDNTEIAVSPRSLHSELMCPICLDMLKKTMTT
Sbjct: 1 MASTEQVGLNKTWELSLYELHRTPQDAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTT 60
Query: 61 KECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQ 120
KECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLR DPNFDLLISKIYPSRDEYEAHQ
Sbjct: 61 KECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDLLISKIYPSRDEYEAHQ 120
Query: 121 VRVLEKLNKSHSQAALVQSINEGIKLQSQHRLQRTKKNIQG-NEENTPDISNTDQTSVQQ 179
RVL KLNKSHSQAALV SI EGIKLQSQ+R QR++KN++ N N +N+ S
Sbjct: 121 ERVLAKLNKSHSQAALVNSITEGIKLQSQNRPQRSRKNVEPENASNATSYNNSQNVSAPA 180
Query: 180 QPSPQPTTSNAI-------KNQLSPA------VPKSPEARPSSAAS-SSTTKVSKKTAKS 225
P+P T + + +N +P+ +PK P+ + S S + ++ +T
Sbjct: 181 TPNPSNTANQSDSSQSTTSRNSTTPSPNPANQIPKPPKRQKSLQNSENDSSSAEAETGGG 240
Query: 226 DVMT------------------------SELETDDT---SETDDKISTVESATDGEVDHL 258
D M +E+ D++ + ++ I +++ + VDHL
Sbjct: 241 DSMVDTEGEGPSEPLMLNEIELVFKPHPTEMAGDNSLIKALKENSIRYIKTTANATVDHL 300
Query: 259 TKYLTMRLRLE-GSDICDS----NFGIYVSPSSNNFILLPGNQSLRQIHDKYWKSEKPLE 313
+KYL MRL L+ +++ +S NF IY++PS ++L G+Q+LRQ++DK+W+ +PLE
Sbjct: 301 SKYLAMRLTLDLDTELSESDRLLNFCIYIAPSPGQLVVLSGSQTLRQVNDKFWRVNRPLE 360
Query: 314 VYYSWKK 320
+YYSWKK
Sbjct: 361 MYYSWKK 367
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307174595|gb|EFN65017.1| E3 ubiquitin-protein ligase RING2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332021896|gb|EGI62232.1| E3 ubiquitin-protein ligase RING2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322796367|gb|EFZ18908.1| hypothetical protein SINV_06659 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|340724527|ref|XP_003400633.1| PREDICTED: e3 ubiquitin-protein ligase RING2-A-like [Bombus terrestris] gi|380021048|ref|XP_003694386.1| PREDICTED: E3 ubiquitin-protein ligase RING2-A-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66523966|ref|XP_393984.2| PREDICTED: e3 ubiquitin-protein ligase RING2-A isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|193643594|ref|XP_001942602.1| PREDICTED: e3 ubiquitin-protein ligase RING1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|380021050|ref|XP_003694387.1| PREDICTED: E3 ubiquitin-protein ligase RING2-A-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|242019424|ref|XP_002430161.1| ubiquitin ligase protein RING2-A, putative [Pediculus humanus corporis] gi|212515252|gb|EEB17423.1| ubiquitin ligase protein RING2-A, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|350425025|ref|XP_003493989.1| PREDICTED: E3 ubiquitin-protein ligase RING2-A-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 321 | ||||||
| FB|FBgn0003330 | 435 | Sce "Sex combs extra" [Drosoph | 0.476 | 0.351 | 0.818 | 3.5e-84 | |
| UNIPROTKB|Q06587 | 406 | RING1 "E3 ubiquitin-protein li | 0.514 | 0.406 | 0.733 | 1.9e-77 | |
| UNIPROTKB|Q5TJF3 | 406 | RING1 "E3 ubiquitin-protein li | 0.514 | 0.406 | 0.727 | 3.9e-77 | |
| UNIPROTKB|A5D9P0 | 406 | RING1 "Ring finger protein 1" | 0.514 | 0.406 | 0.727 | 3.9e-77 | |
| RGD|3576 | 406 | Ring1 "ring finger protein 1" | 0.514 | 0.406 | 0.727 | 3.9e-77 | |
| MGI|MGI:1101770 | 406 | Ring1 "ring finger protein 1" | 0.507 | 0.401 | 0.730 | 1.3e-76 | |
| UNIPROTKB|Q66J69 | 344 | rnf2-a "E3 ubiquitin-protein l | 0.489 | 0.456 | 0.791 | 7.5e-76 | |
| ZFIN|ZDB-GENE-030131-5243 | 336 | rnf2 "ring finger protein 2" [ | 0.514 | 0.491 | 0.739 | 1.6e-75 | |
| UNIPROTKB|F1S3N6 | 336 | RNF2 "Uncharacterized protein" | 0.507 | 0.485 | 0.741 | 2.5e-75 | |
| UNIPROTKB|A6QLQ0 | 336 | RNF2 "RNF2 protein" [Bos tauru | 0.507 | 0.485 | 0.741 | 3.2e-75 |
| FB|FBgn0003330 Sce "Sex combs extra" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 652 (234.6 bits), Expect = 3.5e-84, Sum P(2) = 3.5e-84
Identities = 126/154 (81%), Positives = 138/154 (89%)
Query: 1 MTSTEQSGTTKSWELSMYELNRTPQEAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTT 60
MTS + + K+WELS+YEL R PQE ITD+TEIAVSPRSLHSELMCPICLDMLKKTMTT
Sbjct: 1 MTSLDPA-PNKTWELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTT 59
Query: 61 KECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQ 120
KECLHRFCSDCI+TALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSR+EYEA Q
Sbjct: 60 KECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSREEYEAIQ 119
Query: 121 VRVLEKLNKSHSQAALVQSINEGIKLQSQHRLQR 154
+V+ K N++ SQ ALV SINEGIKLQSQ+R QR
Sbjct: 120 EKVMAKFNQTQSQQALVNSINEGIKLQSQNRPQR 153
|
|
| UNIPROTKB|Q06587 RING1 "E3 ubiquitin-protein ligase RING1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5TJF3 RING1 "E3 ubiquitin-protein ligase RING1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D9P0 RING1 "Ring finger protein 1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|3576 Ring1 "ring finger protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1101770 Ring1 "ring finger protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q66J69 rnf2-a "E3 ubiquitin-protein ligase RING2-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5243 rnf2 "ring finger protein 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S3N6 RNF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QLQ0 RNF2 "RNF2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q4KLY4 | RING2_RAT | 6, ., 3, ., 2, ., - | 0.5485 | 0.7757 | 0.8084 | yes | N/A |
| Q803I4 | RING2_DANRE | 6, ., 3, ., 2, ., - | 0.5044 | 0.9657 | 0.9226 | yes | N/A |
| Q9CQJ4 | RING2_MOUSE | 6, ., 3, ., 2, ., - | 0.5 | 0.9252 | 0.8839 | yes | N/A |
| Q9VB08 | RING1_DROME | 6, ., 3, ., 2, ., - | 0.8424 | 0.4392 | 0.3241 | yes | N/A |
| Q5R9J5 | RING2_PONAB | 6, ., 3, ., 2, ., - | 0.5107 | 0.9283 | 0.8869 | yes | N/A |
| Q8WMN5 | RING1_MACMU | 6, ., 3, ., 2, ., - | 0.7664 | 0.4205 | 0.3580 | yes | N/A |
| Q99496 | RING2_HUMAN | 6, ., 3, ., 2, ., - | 0.5 | 0.9252 | 0.8839 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 321 | |||
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-14 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 6e-14 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 1e-11 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 9e-11 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 2e-08 | |
| COG5222 | 427 | COG5222, COG5222, Uncharacterized conserved protei | 4e-06 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 5e-05 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 0.002 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Score = 65.9 bits (161), Expect = 2e-14
Identities = 18/45 (40%), Positives = 24/45 (53%)
Query: 46 MCPICLDMLKKTMTTKECLHRFCSDCIITALRSGNKECPTCRKKL 90
CPICL+ ++ + C H FC CI L+SG CP CR +
Sbjct: 1 ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45
|
Length = 45 |
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 321 | |||
| KOG0311|consensus | 381 | 100.0 | ||
| KOG2660|consensus | 331 | 99.96 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.3 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.26 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.23 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.16 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.11 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.08 | |
| KOG0287|consensus | 442 | 99.08 | ||
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.94 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.83 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.8 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.77 | |
| KOG2177|consensus | 386 | 98.76 | ||
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.76 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.72 | |
| KOG0320|consensus | 187 | 98.71 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.7 | |
| KOG0823|consensus | 230 | 98.6 | ||
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.59 | |
| KOG0317|consensus | 293 | 98.57 | ||
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.57 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.52 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.43 | |
| KOG2164|consensus | 513 | 98.39 | ||
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.38 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 98.36 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.31 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.25 | |
| KOG0978|consensus | 698 | 98.15 | ||
| KOG0297|consensus | 391 | 98.05 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.03 | |
| KOG4159|consensus | 398 | 98.0 | ||
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.96 | |
| KOG2879|consensus | 298 | 97.75 | ||
| KOG4628|consensus | 348 | 97.74 | ||
| KOG0824|consensus | 324 | 97.67 | ||
| KOG0802|consensus | 543 | 97.65 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.63 | |
| KOG1813|consensus | 313 | 97.61 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.55 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.37 | |
| KOG1002|consensus | 791 | 97.07 | ||
| KOG1645|consensus | 463 | 96.93 | ||
| KOG3800|consensus | 300 | 96.85 | ||
| KOG0804|consensus | 493 | 96.65 | ||
| KOG1039|consensus | 344 | 96.53 | ||
| KOG1785|consensus | 563 | 96.28 | ||
| KOG4172|consensus | 62 | 96.28 | ||
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.1 | |
| PF11816 | 331 | DUF3337: Domain of unknown function (DUF3337); Int | 96.09 | |
| KOG4265|consensus | 349 | 96.07 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.07 | |
| KOG0825|consensus | 1134 | 95.97 | ||
| KOG4367|consensus | 699 | 95.94 | ||
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 95.92 | |
| KOG1734|consensus | 328 | 95.91 | ||
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.68 | |
| KOG3039|consensus | 303 | 95.66 | ||
| KOG0828|consensus | 636 | 95.53 | ||
| KOG3039|consensus | 303 | 95.48 | ||
| cd01612 | 87 | APG12_C Ubiquitin-like domain of APG12. APG12_C Th | 95.35 | |
| KOG4692|consensus | 489 | 95.25 | ||
| KOG0827|consensus | 465 | 95.12 | ||
| KOG1493|consensus | 84 | 95.02 | ||
| PF04110 | 87 | APG12: Ubiquitin-like autophagy protein Apg12 ; In | 94.99 | |
| KOG4185|consensus | 296 | 94.86 | ||
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 94.81 | |
| KOG4739|consensus | 233 | 94.78 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.76 | |
| KOG1571|consensus | 355 | 94.72 | ||
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 94.42 | |
| KOG3002|consensus | 299 | 94.34 | ||
| KOG1001|consensus | 674 | 94.26 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 94.06 | |
| KOG2817|consensus | 394 | 93.66 | ||
| KOG4362|consensus | 684 | 93.66 | ||
| KOG0826|consensus | 357 | 93.62 | ||
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 93.54 | |
| KOG4275|consensus | 350 | 92.94 | ||
| KOG3161|consensus | 861 | 92.42 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 90.33 | |
| cd01611 | 112 | GABARAP Ubiquitin domain of GABA-receptor-associat | 90.25 | |
| KOG2930|consensus | 114 | 89.77 | ||
| KOG0298|consensus | 1394 | 89.66 | ||
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 89.18 | |
| KOG1814|consensus | 445 | 88.8 | ||
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 88.75 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 88.38 | |
| KOG2114|consensus | 933 | 87.64 | ||
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 87.35 | |
| PHA03096 | 284 | p28-like protein; Provisional | 87.28 | |
| PF02991 | 104 | Atg8: Autophagy protein Atg8 ubiquitin like; Inter | 87.18 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 87.18 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 87.04 | |
| KOG1941|consensus | 518 | 86.33 | ||
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 84.83 | |
| PTZ00380 | 121 | microtubule-associated protein (MAP); Provisional | 82.96 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 82.03 | |
| COG3813 | 84 | Uncharacterized protein conserved in bacteria [Fun | 81.58 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 81.19 | |
| PF13764 | 802 | E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 | 81.18 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 81.16 | |
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 81.15 | |
| PHA02862 | 156 | 5L protein; Provisional | 80.83 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 80.35 |
| >KOG0311|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.8e-41 Score=313.06 Aligned_cols=307 Identities=37% Similarity=0.570 Sum_probs=223.8
Q ss_pred CCCCccccceeeeccCCcccccCccccccCccCCCCcccccccccCcccceecCCCCCcccHhHHHHHHhcCCCCCCCcc
Q psy17011 8 GTTKSWELSMYELNRTPQEAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIITALRSGNKECPTCR 87 (321)
Q Consensus 8 ~~~~~~~~~~~e~~~~~~~~i~~~~~~~~~~~~l~~~l~C~IC~~~l~~Pvtl~~CgHtFC~~CI~~~l~~~~~~CP~Cr 87 (321)
..+++|||++|+++|+|+.+++|++++.+.++.|+.+++|+||+++++..+++++|+|.||..||...++.++..||.||
T Consensus 7 a~~e~~El~l~~~er~p~~~~~d~~Ei~~~l~~~~~~v~c~icl~llk~tmttkeClhrfc~~ci~~a~r~gn~ecptcR 86 (381)
T KOG0311|consen 7 AREEGRELELDSKERSPSSYNGDPSEIMVDLAMFDIQVICPICLSLLKKTMTTKECLHRFCFDCIWKALRSGNNECPTCR 86 (381)
T ss_pred ccchhhhcchhhhhcChhhhcCCchhheecHHHhhhhhccHHHHHHHHhhcccHHHHHHHHHHHHHHHHHhcCCCCchHH
Confidence 36999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccccCCCChHHHHHHHHHcCChHHHHHHHHHHHHHHhhcchhhhhhhhHHHHHHHHHHHHHHhhhhhccCC-CCCC
Q psy17011 88 KKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQVRVLEKLNKSHSQAALVQSINEGIKLQSQHRLQRTKKNIQGN-EENT 166 (321)
Q Consensus 88 ~~~~~~~~l~~n~~l~~lv~kl~~~~~~c~~h~e~l~~~~~~~~~~~~l~~~~~e~~k~q~q~r~~~lk~~~~e~-~~~~ 166 (321)
+.+.+++.++.|+.+..||.+++++...++.++.+++++....+.+ ++..+++++.+.|.+.+.+|+....... ..+.
T Consensus 87 k~l~SkrsLr~Dp~fdaLis~i~~sie~~e~~q~~~~ekd~~~~~q-~i~~si~~~~~~qs~~~~kr~a~~~~~s~r~g~ 165 (381)
T KOG0311|consen 87 KKLVSKRSLRIDPNFDALISKIYPSIEEYEAPQPRFMEKDDSAQIQ-YIKTSINAAVDHQSSYLTKRKALEELRSIRWGG 165 (381)
T ss_pred hhccccccCCCCccHHHHHHHHhccHHHHhccchhHHhhHHHHhHH-HHhhhHHHHHhhhhhhhhhhhcccccccccccC
Confidence 9999999999999999999999999999999999999998888887 8889999999999999988876522100 0011
Q ss_pred CCCCCCCCCcc-cC-CCCCCCCCCcccccCCC--------CCCCCCCCCCCCCCCCCCcccccc------cccCCC-CCC
Q psy17011 167 PDISNTDQTSV-QQ-QPSPQPTTSNAIKNQLS--------PAVPKSPEARPSSAASSSTTKVSK------KTAKSD-VMT 229 (321)
Q Consensus 167 ~~~~~~~~~~~-~~-~~~~~~~~s~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~------e~~~~~-~~~ 229 (321)
++...+..+.. ++ ..++..++.+...+... ...++...+++.+ +.|.++.. .|.+.+ -++
T Consensus 166 Gs~~~gn~r~~~~s~~~a~~ea~~~~~~n~rg~~ss~d~~~~~~~~~~S~d~~---~~~~~~s~as~~~~~~~~a~te~~ 242 (381)
T KOG0311|consen 166 GSRRRGNVRNVEQSKKSAPKEADGNDDENDRGKDSSSDELMDFPREIRSSDRE---QTHPSSSGASMNDSNCAGADTEDV 242 (381)
T ss_pred CCCCCCCcccchhccccCCccCCCccccccccccccccccccccccccccccc---cCCCCccccccCCCcccCCCCccc
Confidence 11111111110 01 11111111111110000 0000000011110 11111110 111110 011
Q ss_pred cccc----------cCCCCCCCCeEEcCCCCCcchhhhHHHHHHHHhccCCC--C-------------------------
Q psy17011 230 SELE----------TDDTSETDDKISTVESATDGEVDHLTKYLTMRLRLEGS--D------------------------- 272 (321)
Q Consensus 230 ~e~e----------~~~~~~~~ryi~~sa~~~~aTV~HL~KyLa~rl~l~~~--~------------------------- 272 (321)
.+++ .....-+.+|...+.+ ++++|++||++.|.+++.. +
T Consensus 243 ~~~~~i~r~~v~~~e~~~s~r~~~~~~t~n---~~~~~~~k~~~vr~a~~~~~~e~~~~~~G~S~~~~~~~~~~~~~~~~ 319 (381)
T KOG0311|consen 243 RDSSTISRTLVWNRESSESGRGGTRSNTRN---GNNKMGRKSLAVRNALEVRLSEYDGSVEGTSNIKVAKKKPLKREEVE 319 (381)
T ss_pred ccccccccccccccccchhccCCccccccc---cccccccchhhhhHHHHHHhhhhcccccccccccccccCCccccccc
Confidence 2222 1122244599999999 9999999999999988651 0
Q ss_pred ------c-----CCcceEEEeecCCCceeeCCCCchHHHHHHhhcCCCCCeEEEeeeccC
Q psy17011 273 ------I-----CDSNFGIYVSPSSNNFILLPGNQSLRQIHDKYWKSEKPLEVYYSWKKV 321 (321)
Q Consensus 273 ------~-----~~~~~~iyi~~~~~~~~~L~~~~TL~~V~~~~Wk~~~Pl~l~Y~~~~~ 321 (321)
+ .+.+|+|||++..++|+.|+|+.||..|.++||++++||+|+|.++|.
T Consensus 320 ~~~~~~~~~d~~~enn~~iy~a~~~~~~~~Lng~~Tls~v~~df~kvn~~m~l~~~~kk~ 379 (381)
T KOG0311|consen 320 LLVELIHPLDTASENNYTIYIATSKDQFTSLNGDETLSLVKEDFWKVNEPMELSYHEKKI 379 (381)
T ss_pred ccccccccccccccccceeEeecCCCceEEecccchHHHHhhhhhhcccchhhhhchhcc
Confidence 1 125899999999999999999999999999999999999999999984
|
|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >cd01612 APG12_C Ubiquitin-like domain of APG12 | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF02991 Atg8: Autophagy protein Atg8 ubiquitin like; InterPro: IPR004241 Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >PTZ00380 microtubule-associated protein (MAP); Provisional | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >COG3813 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 321 | ||||
| 2ckl_B | 165 | Ring1b-Bmi1 E3 Catalytic Domain Structure Length = | 2e-67 | ||
| 3rpg_C | 121 | Bmi1RING1B-Ubch5c Complex Structure Length = 121 | 4e-51 | ||
| 2h0d_B | 100 | Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti | 2e-49 | ||
| 3gs2_A | 111 | Ring1b C-Terminal DomainCBX7 CBOX COMPLEX Length = | 2e-09 | ||
| 3h8h_A | 112 | Structure Of The C-Terminal Domain Of Human Rnf2RIN | 3e-09 | ||
| 2h0d_A | 97 | Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti | 4e-06 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 1e-05 | ||
| 3rpg_B | 117 | Bmi1RING1B-Ubch5c Complex Structure Length = 117 | 2e-05 | ||
| 2ysl_A | 73 | Solution Structure Of The Ring Domain (1-66) From T | 2e-05 | ||
| 2ckl_A | 108 | Ring1b-Bmi1 E3 Catalytic Domain Structure Length = | 2e-05 | ||
| 2eci_A | 86 | Solution Structure Of The Ring Domain Of The Human | 3e-05 | ||
| 2jmd_A | 63 | Solution Structure Of The Ring Domain Of Human Traf | 4e-05 | ||
| 2ysj_A | 63 | Solution Structure Of The Ring Domain (1-56) From T | 4e-05 | ||
| 3ng2_A | 71 | Crystal Structure Of The Rnf4 Ring Domain Dimer Len | 8e-05 | ||
| 2xeu_A | 64 | Ring Domain Length = 64 | 9e-05 | ||
| 4ap4_A | 133 | Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le | 1e-04 | ||
| 3hct_A | 118 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 2e-04 | ||
| 3hcs_A | 170 | Crystal Structure Of The N-Terminal Domain Of Traf6 | 3e-04 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 4e-04 | ||
| 2ea6_A | 69 | Solution Structure Of The Ring Domain Of The Human | 6e-04 | ||
| 1z6u_A | 150 | Np95-Like Ring Finger Protein Isoform B [homo Sapie | 7e-04 |
| >pdb|2CKL|B Chain B, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 165 | Back alignment and structure |
|
| >pdb|3RPG|C Chain C, Bmi1RING1B-Ubch5c Complex Structure Length = 121 | Back alignment and structure |
| >pdb|2H0D|B Chain B, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 100 | Back alignment and structure |
| >pdb|3GS2|A Chain A, Ring1b C-Terminal DomainCBX7 CBOX COMPLEX Length = 111 | Back alignment and structure |
| >pdb|3H8H|A Chain A, Structure Of The C-Terminal Domain Of Human Rnf2RING1B Length = 112 | Back alignment and structure |
| >pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
| >pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117 | Back alignment and structure |
| >pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 | Back alignment and structure |
| >pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108 | Back alignment and structure |
| >pdb|2ECI|A Chain A, Solution Structure Of The Ring Domain Of The Human Tnf Receptor-Associated Factor 6 Protein Length = 86 | Back alignment and structure |
| >pdb|2JMD|A Chain A, Solution Structure Of The Ring Domain Of Human Traf6 Length = 63 | Back alignment and structure |
| >pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 | Back alignment and structure |
| >pdb|3NG2|A Chain A, Crystal Structure Of The Rnf4 Ring Domain Dimer Length = 71 | Back alignment and structure |
| >pdb|2XEU|A Chain A, Ring Domain Length = 64 | Back alignment and structure |
| >pdb|4AP4|A Chain A, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 133 | Back alignment and structure |
| >pdb|3HCT|A Chain A, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 118 | Back alignment and structure |
| >pdb|3HCS|A Chain A, Crystal Structure Of The N-Terminal Domain Of Traf6 Length = 170 | Back alignment and structure |
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
| >pdb|2EA6|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 4 Length = 69 | Back alignment and structure |
| >pdb|1Z6U|A Chain A, Np95-Like Ring Finger Protein Isoform B [homo Sapiens] Length = 150 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
Score = 192 bits (490), Expect = 1e-61
Identities = 118/154 (76%), Positives = 132/154 (85%)
Query: 1 MTSTEQSGTTKSWELSMYELNRTPQEAITDNTEIAVSPRSLHSELMCPICLDMLKKTMTT 60
+ + +K+WELS+YEL RTPQEAITD EI VSPRSLHSELMCPICLDMLK TMTT
Sbjct: 11 VQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTT 70
Query: 61 KECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSRDEYEAHQ 120
KECLHRFC+DCIITALRSGNKECPTCRKKLVSKRSLR DPNFD LISKIYPSRDEYEAHQ
Sbjct: 71 KECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQ 130
Query: 121 VRVLEKLNKSHSQAALVQSINEGIKLQSQHRLQR 154
RVL ++NK ++Q AL SI EG+K+Q+ +RLQR
Sbjct: 131 ERVLARINKHNNQQALSHSIEEGLKIQAMNRLQR 164
|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3gs2_A E3 ubiquitin-protein ligase RING2; RING1B, CBOX, CBX7, polycomb, E3-ligase, chromosomal protein transcription regulation, chromatin regulator; 1.70A {Homo sapiens} PDB: 3ixs_A* 3h8h_A* Length = 111 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Length = 360 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 321 | |||
| 3gs2_A | 111 | E3 ubiquitin-protein ligase RING2; RING1B, CBOX, C | 100.0 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.9 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.59 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.59 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.59 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.58 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.58 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.56 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.54 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.52 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.5 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.47 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.46 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.44 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.44 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.43 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.42 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.42 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.41 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.4 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.39 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.39 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.38 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.38 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.37 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.37 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.36 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.36 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.36 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.34 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.33 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.3 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.26 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.24 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.24 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.23 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.21 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.21 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.2 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.12 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.1 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.1 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.07 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.07 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.06 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.04 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.01 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.01 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.0 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.97 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.97 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.96 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.94 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.89 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.8 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.79 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.79 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.76 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.72 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.63 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.61 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.56 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.55 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.54 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.45 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.43 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.3 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.28 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.92 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.69 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.33 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.19 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 97.0 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.42 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 95.83 | |
| 4gdk_A | 91 | Ubiquitin-like protein ATG12; protein-protein conj | 94.22 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 93.06 | |
| 2zjd_A | 130 | Microtubule-associated proteins 1A/1B light chain | 93.0 | |
| 3w1s_C | 91 | Ubiquitin-like protein ATG12; ubiquitin fold, E3-l | 92.44 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 92.09 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 91.5 | |
| 3rui_B | 118 | Autophagy-related protein 8; autophagosome formati | 91.06 | |
| 1eo6_A | 117 | GATE-16, golgi-associated ATPase enhancer of 16 KD | 89.57 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 88.95 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 88.38 | |
| 1wz3_A | 96 | Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla | 87.92 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 86.72 | |
| 3h9d_A | 119 | ATG8, microtubule-associated protein 1A/1B, light | 85.57 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 85.48 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 85.41 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 85.11 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 84.99 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 84.97 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 84.73 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 84.45 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 84.33 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 83.98 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 83.98 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 83.52 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 83.03 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 82.94 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 82.9 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 82.81 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 82.39 | |
| 3m95_A | 125 | Autophagy related protein ATG8; alpha slash beta, | 82.35 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 81.59 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 81.35 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 81.24 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 80.51 |
| >3gs2_A E3 ubiquitin-protein ligase RING2; RING1B, CBOX, CBX7, polycomb, E3-ligase, chromosomal protein transcription regulation, chromatin regulator; 1.70A {Homo sapiens} PDB: 3ixs_A* 3h8h_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-34 Score=226.88 Aligned_cols=81 Identities=40% Similarity=0.719 Sum_probs=73.2
Q ss_pred CCCCCCeEEcCCCCCcchhhhHHHHHHHHhccCC------------CCcCCcceEEEeecCCCceeeCCCCchHHHHHHh
Q psy17011 237 TSETDDKISTVESATDGEVDHLTKYLTMRLRLEG------------SDICDSNFGIYVSPSSNNFILLPGNQSLRQIHDK 304 (321)
Q Consensus 237 ~~~~~ryi~~sa~~~~aTV~HL~KyLa~rl~l~~------------~~~~~~~~~iyi~~~~~~~~~L~~~~TL~~V~~~ 304 (321)
...++|||||+++ ||||||+||||||++|+. ..+++.||+|||++++|||++|+|++||++|++|
T Consensus 19 ~~~~~RYIKTt~n---ATVDHLsKYLA~Rl~Le~~~~~~e~~~~~~~~~~~~~~~IYia~~~gq~~~L~gs~tLe~VneK 95 (111)
T 3gs2_A 19 DSAQTRYIKTSGN---ATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLDGSFSLELVSEK 95 (111)
T ss_dssp TTCCCEEEEEETT---CBHHHHHHHHHHHHHHHHHHHHHHSSCCSCCC--CCCEEEEEECTTSCEEECCTTSBHHHHHHH
T ss_pred chhceEEEEcCCC---ccHHHHHHHHHHHHhHHHhhccccccccCccccceeeeEEEEccCCCeEEEccCcccHHHHhhh
Confidence 3367899999999 999999999999999983 1234579999999999999999999999999999
Q ss_pred hcCCCCCeEEEeeecc
Q psy17011 305 YWKSEKPLEVYYSWKK 320 (321)
Q Consensus 305 ~Wk~~~Pl~l~Y~~~~ 320 (321)
|||+++||+|||+|+|
T Consensus 96 ywkvnkplelYYa~~k 111 (111)
T 3gs2_A 96 YWKVNKPMELYYAPTK 111 (111)
T ss_dssp HTCSSSCEEEEEEECC
T ss_pred hccCCCCeeEEecccC
Confidence 9999999999999987
|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A | Back alignment and structure |
|---|
| >3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* | Back alignment and structure |
|---|
| >1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 321 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 3e-14 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 4e-14 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-11 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-11 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-10 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-10 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 3e-09 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 1e-08 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-07 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 3e-07 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 8e-07 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 3e-06 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 1e-05 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 1e-05 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 5e-04 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 0.004 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 65.0 bits (158), Expect = 3e-14
Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 2/79 (2%)
Query: 23 TPQEAITDNTEIAVSPRSLHSEL-MCPICLDMLKKTMTTKECLHRFCSDCIITALRSGNK 81
TPQ+ I E + S +C IC + K C H C+ C+ + S +
Sbjct: 1 TPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEP-CGHLMCTSCLTSWQESEGQ 59
Query: 82 ECPTCRKKLVSKRSLRADP 100
CP CR ++ + DP
Sbjct: 60 GCPFCRCEIKGTEPIVVDP 78
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 321 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.63 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.6 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.56 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.52 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.48 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.47 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.33 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.16 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.12 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.11 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.06 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.0 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.7 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.56 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.46 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.84 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 94.02 | |
| d1wz3a1 | 84 | Autophagy-related protein 12b (APG12b) {Thale cres | 94.01 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 92.59 | |
| d2zjda1 | 119 | Microtubule-associated proteins 1A/1B light chain | 90.49 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 89.85 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 89.8 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 87.31 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 87.23 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 86.75 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 86.49 | |
| d3d32a1 | 118 | GABA(A) receptor associated protein GABARAP {Human | 85.9 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 85.83 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 85.44 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 84.67 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 84.19 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 83.96 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 83.68 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 83.59 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 83.42 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 82.5 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 82.02 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.63 E-value=9.6e-17 Score=120.90 Aligned_cols=71 Identities=15% Similarity=0.184 Sum_probs=63.7
Q ss_pred cCCCCcccccccccCcccceecCCCCCcccHhHHHHHHhcCCCCCCCccccccccccCCCChHHHHHHHHHcC
Q psy17011 39 RSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIITALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYP 111 (321)
Q Consensus 39 ~~l~~~l~C~IC~~~l~~Pvtl~~CgHtFC~~CI~~~l~~~~~~CP~Cr~~~~~~~~l~~n~~l~~lv~kl~~ 111 (321)
+++.++|.||||+++|.+||+++ |||+||+.||.+|+..+...||.|+.++. ...+.+|..|+++|+.+..
T Consensus 2 ~eiP~~l~CpIc~~l~~dPv~~~-cGhtfc~~ci~~~l~~~~~~cP~c~~~l~-~~~l~pN~~L~~~I~~~l~ 72 (80)
T d2c2la2 2 RDIPDYLCGKISFELMREPCITP-SGITYDRKDIEEHLQRVGHFNPVTRSPLT-QEQLIPNLAMKEVIDAFIS 72 (80)
T ss_dssp CCCCSTTBCTTTCSBCSSEEECS-SCCEEETTHHHHHHHHTCSSCTTTCCCCC-GGGCEECHHHHHHHHHHHT
T ss_pred CCCCccccCcCcCchhhhhcccC-CcCeecHHHHHHHHhcCCccCCCcccccc-ccccccHHHHHHHHHHHHH
Confidence 35678999999999999999998 99999999999999876778999999986 5688899999999998753
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wz3a1 d.15.1.7 (A:10-93) Autophagy-related protein 12b (APG12b) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|