Diaphorina citri psyllid: psy1701

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270

MSTSTSVNFQEFWIDARGFRDNHSGHFMYLLCTYAVTDLPDTSTRHNVAPFTQFPLFFSTVLFAMEGIGTVLPIENSMKKPGHFLGKFGVLNIAMAVVISFYGMVGYCGYLKYGEDTKGSITLNLPKDPFSESIKILVALSILFTYGLQFGVPSEIVWERIKHRVPIPRHNMGYYIMRGLMIIGTVLVAAIIPNLGPIISLVGAICFSMLGLFCPAVIDYVTFYDPNKSWYRPRTIKNFIIILISLGALISGTYSSIEEIIAFYAINPFF

cccccccccHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccccccccccHHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc

*****SVNFQEFWIDARGFRDNHSGHFMYLLCTYAVTDLPDTSTRHNVAPFTQFPLFFSTVLFAMEGIGTVLPIENSMKKPGHFLGKFGVLNIAMAVVISFYGMVGYCGYLKYGEDTKGSITLNLPKDPFSESIKILVALSILFTYGLQFGVPSEIVWERIKHRVPIPRHNMGYYIMRGLMIIGTVLVAAIIPNLGPIISLVGAICFSMLGLFCPAVIDYVTFYDPNKSWYRPRTIKNFIIILISLGALISGTYSSIEEIIAFYAINPFF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0008324 [MF]	cation transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015808 [BP]	L-alanine transport	probable	GO:0071705, GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0015804, GO:0044765, GO:0015807, GO:0008150, GO:0015849, GO:0032328, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0015824 [BP]	proline transport	probable	GO:0071705, GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0015804, GO:0044765, GO:0008150, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:probable
Coverage over the Query: 53-227
View the alignment between query and template
View the model in PyMOL