Diaphorina citri psyllid: psy17021


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE
ccEEEEccccccCEEECccccEEEEEEEcEEEEEEccHHHHHHcccccEEEEcEEEEEEEEEEECcccccccccEEEEEEECccccCEEEcccccEEEEEEccEEEEEEccccEEEEEEEEcccccEEEEEEEEccEEEEECccccEEEEEEEccccEEEEEEcccccCEEEEEEEECccCEEEEcccccEEEEEEccc
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor 3B subunit 3 Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.confidentQ15393
Splicing factor 3B subunit 3 Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.confidentQ921M3
Splicing factor 3B subunit 3 Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.confidentA0JN52

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003006 [BP]developmental process involved in reproductionprobableGO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0043933 [BP]macromolecular complex subunit organizationprobableGO:0008150, GO:0071840, GO:0016043
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0005689 [CC]U12-type spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0090304 [BP]nucleic acid metabolic processprobableGO:0006139, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EI3, chain A
Confidence level:very confident
Coverage over the Query: 72-199
View the alignment between query and template
View the model in PyMOL
Template: 3BWS, chain A
Confidence level:probable
Coverage over the Query: 4-196
View the alignment between query and template
View the model in PyMOL