Psyllid ID: psy17021


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE
ccEEEEccccccEEEEEccccEEEEEEEcEEEEEEccHHHHHHcccccEEEEcEEEEEEEEEEEEcccccccccEEEEEEEEccccEEEEcccccEEEEEEccEEEEEEccccEEEEEEEEcccccEEEEEEEEccEEEEEEccccEEEEEEEccccEEEEEEcccccEEEEEEEEEEccEEEEEcccccEEEEEEccc
ccEEEEcccccccHHHcccccEEEEEccccEEEEcccHHHHHHHHHccccccccEEEEEEEEEEccccEEcccEEEEEEEcccccccHHHHHcccEEEEEEccEEEEEEccHHHHHHHHHccccccEEEEEEEcccEEEEEccccEEEEEEEccccccEEEEHcccccccEEEEEEEccccEEEEcccccEEEEEcccc
mefvhktsvdevpyamcpfqgaLLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQththsgrsdrlvgNAMEFVhktsvdevpyamcpfqgaLLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMghriyvsdvqESVFLVRYKRYENQLlifaddtqprwittscvldyntvasadkfGNVCIVSTYRE
mefvhktsvdevpyaMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIkgfrkahqththsgrsdrlvgNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLlifaddtqprWITTSCVLdyntvasadkfgnvcivstyre
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE
********VDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAH**********RLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVST***
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYR*
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKG**************DRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q1LVE8 1217 Splicing factor 3B subuni yes N/A 0.618 0.101 0.699 1e-50
Q921M3 1217 Splicing factor 3B subuni yes N/A 0.613 0.100 0.682 5e-48
Q5RBI5 1217 Splicing factor 3B subuni yes N/A 0.613 0.100 0.682 5e-48
Q15393 1217 Splicing factor 3B subuni yes N/A 0.613 0.100 0.682 5e-48
A0JN52 1217 Splicing factor 3B subuni yes N/A 0.613 0.100 0.682 5e-48
Q54SA7 1256 Probable splicing factor yes N/A 0.582 0.092 0.577 2e-39
Q4PGM6 1221 Pre-mRNA-splicing factor N/A N/A 0.618 0.100 0.520 9e-36
P0CR22 1217 Pre-mRNA-splicing factor yes N/A 0.613 0.100 0.544 2e-33
P0CR23 1217 Pre-mRNA-splicing factor N/A N/A 0.613 0.100 0.544 2e-33
Q7RYR4 1209 Pre-mRNA-splicing factor N/A N/A 0.819 0.134 0.409 2e-32
>sp|Q1LVE8|SF3B3_DANRE Splicing factor 3B subunit 3 OS=Danio rerio GN=sf3b3 PE=2 SV=1 Back     alignment and function desciption
 Score =  199 bits (505), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 109/123 (88%)

Query: 72   GNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKI 131
            G+ +EF+HKT V++VP A+ PFQG +LVGVG+ LR+YDLGKKKLLRKCENKH+PNL+  I
Sbjct: 934  GDKLEFLHKTPVEDVPLAIAPFQGRVLVGVGKLLRIYDLGKKKLLRKCENKHVPNLVTGI 993

Query: 132  ESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNV 191
             ++G R+ VSDVQES+F VRY+R ENQL+IFADDT PRWITT+C+LDY+T+ASADKFGN+
Sbjct: 994  HTIGQRVIVSDVQESLFWVRYRRNENQLIIFADDTYPRWITTACLLDYDTMASADKFGNI 1053

Query: 192  CIV 194
            C+V
Sbjct: 1054 CVV 1056




Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.
Danio rerio (taxid: 7955)
>sp|Q921M3|SF3B3_MOUSE Splicing factor 3B subunit 3 OS=Mus musculus GN=Sf3b3 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBI5|SF3B3_PONAB Splicing factor 3B subunit 3 OS=Pongo abelii GN=SF3B3 PE=2 SV=1 Back     alignment and function description
>sp|Q15393|SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 Back     alignment and function description
>sp|A0JN52|SF3B3_BOVIN Splicing factor 3B subunit 3 OS=Bos taurus GN=SF3B3 PE=2 SV=1 Back     alignment and function description
>sp|Q54SA7|SF3B3_DICDI Probable splicing factor 3B subunit 3 OS=Dictyostelium discoideum GN=sf3b3 PE=3 SV=1 Back     alignment and function description
>sp|Q4PGM6|RSE1_USTMA Pre-mRNA-splicing factor RSE1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RSE1 PE=3 SV=1 Back     alignment and function description
>sp|P0CR22|RSE1_CRYNJ Pre-mRNA-splicing factor RSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RSE1 PE=3 SV=1 Back     alignment and function description
>sp|P0CR23|RSE1_CRYNB Pre-mRNA-splicing factor RSE1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RSE1 PE=3 SV=1 Back     alignment and function description
>sp|Q7RYR4|RSE1_NEUCR Pre-mRNA-splicing factor rse-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rse-1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
351712542 1240 Splicing factor 3B subunit 3 [Heteroceph 0.814 0.130 0.587 1e-60
383847297 1217 PREDICTED: splicing factor 3B subunit 3- 0.613 0.100 0.729 8e-51
66553024 1217 PREDICTED: splicing factor 3B subunit 3 0.603 0.098 0.733 1e-50
340721347 1217 PREDICTED: splicing factor 3B subunit 3- 0.603 0.098 0.733 1e-50
91092128 1219 PREDICTED: similar to AGAP005549-PA [Tri 0.623 0.101 0.725 6e-50
322797581 1217 hypothetical protein SINV_00421 [Solenop 0.613 0.100 0.704 1e-49
307205956 1217 Splicing factor 3B subunit 3 [Harpegnath 0.603 0.098 0.716 1e-49
332026090 1217 Splicing factor 3B subunit 3 [Acromyrmex 0.613 0.100 0.704 2e-49
326676028 1217 PREDICTED: splicing factor 3B subunit 3- 0.618 0.101 0.699 7e-49
47087273 1217 splicing factor 3B subunit 3 [Danio reri 0.618 0.101 0.699 8e-49
>gi|351712542|gb|EHB15461.1| Splicing factor 3B subunit 3 [Heterocephalus glaber] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/194 (58%), Positives = 140/194 (72%), Gaps = 32/194 (16%)

Query: 1    MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQT 60
            +EF+HKT V+EVP A+ PFQG +L+GVG+ LR+YDLGKKKLLRKCENK            
Sbjct: 918  LEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENK------------ 965

Query: 61   HTHSGRSDRLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCE 120
                                T V+EVP A+ PFQG +L+GVG+ LR+YDLGKKKLLRKCE
Sbjct: 966  --------------------TPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCE 1005

Query: 121  NKHLPNLIVKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYN 180
            NKH+ N I  I+++GHR+ VSDVQES   VRYKR ENQL+IFADDT PRW+TT+ +LDY+
Sbjct: 1006 NKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYD 1065

Query: 181  TVASADKFGNVCIV 194
            TVA ADKFGN+C+V
Sbjct: 1066 TVAGADKFGNICVV 1079




Source: Heterocephalus glaber

Species: Heterocephalus glaber

Genus: Heterocephalus

Family: Bathyergidae

Order: Rodentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|383847297|ref|XP_003699291.1| PREDICTED: splicing factor 3B subunit 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66553024|ref|XP_623333.1| PREDICTED: splicing factor 3B subunit 3 isoform 1 [Apis mellifera] gi|380015815|ref|XP_003691890.1| PREDICTED: splicing factor 3B subunit 3-like [Apis florea] Back     alignment and taxonomy information
>gi|340721347|ref|XP_003399083.1| PREDICTED: splicing factor 3B subunit 3-like [Bombus terrestris] gi|350406701|ref|XP_003487854.1| PREDICTED: splicing factor 3B subunit 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|91092128|ref|XP_972649.1| PREDICTED: similar to AGAP005549-PA [Tribolium castaneum] gi|270004662|gb|EFA01110.1| hypothetical protein TcasGA2_TC010322 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322797581|gb|EFZ19622.1| hypothetical protein SINV_00421 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307205956|gb|EFN84082.1| Splicing factor 3B subunit 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332026090|gb|EGI66238.1| Splicing factor 3B subunit 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|326676028|ref|XP_002667683.2| PREDICTED: splicing factor 3B subunit 3-like [Danio rerio] gi|123888555|sp|Q1LVE8.1|SF3B3_DANRE RecName: Full=Splicing factor 3B subunit 3 Back     alignment and taxonomy information
>gi|47087273|ref|NP_998668.1| splicing factor 3B subunit 3 [Danio rerio] gi|28502779|gb|AAH47171.1| Splicing factor 3b, subunit 3 [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
ZFIN|ZDB-GENE-040426-2901 1217 sf3b3 "splicing factor 3b, sub 0.618 0.101 0.699 1.9e-45
UNIPROTKB|F1NZF7 504 SF3B3 "Uncharacterized protein 0.618 0.244 0.682 1.5e-44
UNIPROTKB|F1S419319 LOC100512659 "Uncharacterized 0.618 0.385 0.682 1.9e-44
RGD|1311636 902 Sf3b3 "splicing factor 3b, sub 0.618 0.136 0.682 1.5e-43
UNIPROTKB|E9PT66 920 Sf3b3 "Protein Sf3b3" [Rattus 0.618 0.133 0.682 1.6e-43
UNIPROTKB|A0JN52 1217 SF3B3 "Splicing factor 3B subu 0.618 0.101 0.682 3.3e-43
UNIPROTKB|E2RR33 1217 SF3B3 "Uncharacterized protein 0.618 0.101 0.682 3.3e-43
UNIPROTKB|Q15393 1217 SF3B3 "Splicing factor 3B subu 0.618 0.101 0.682 3.3e-43
MGI|MGI:1289341 1217 Sf3b3 "splicing factor 3b, sub 0.618 0.101 0.682 3.3e-43
FB|FBgn0035162 1227 CG13900 [Drosophila melanogast 0.608 0.098 0.661 9e-43
ZFIN|ZDB-GENE-040426-2901 sf3b3 "splicing factor 3b, subunit 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 489 (177.2 bits), Expect = 1.9e-45, P = 1.9e-45
 Identities = 86/123 (69%), Positives = 109/123 (88%)

Query:    72 GNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKI 131
             G+ +EF+HKT V++VP A+ PFQG +LVGVG+ LR+YDLGKKKLLRKCENKH+PNL+  I
Sbjct:   934 GDKLEFLHKTPVEDVPLAIAPFQGRVLVGVGKLLRIYDLGKKKLLRKCENKHVPNLVTGI 993

Query:   132 ESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNV 191
              ++G R+ VSDVQES+F VRY+R ENQL+IFADDT PRWITT+C+LDY+T+ASADKFGN+
Sbjct:   994 HTIGQRVIVSDVQESLFWVRYRRNENQLIIFADDTYPRWITTACLLDYDTMASADKFGNI 1053

Query:   192 CIV 194
             C+V
Sbjct:  1054 CVV 1056


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005681 "spliceosomal complex" evidence=IEA
GO:0006397 "mRNA processing" evidence=IEA
GO:0008380 "RNA splicing" evidence=IEA
UNIPROTKB|F1NZF7 SF3B3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S419 LOC100512659 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1311636 Sf3b3 "splicing factor 3b, subunit 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PT66 Sf3b3 "Protein Sf3b3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A0JN52 SF3B3 "Splicing factor 3B subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR33 SF3B3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15393 SF3B3 "Splicing factor 3B subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1289341 Sf3b3 "splicing factor 3b, subunit 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0035162 CG13900 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q921M3SF3B3_MOUSENo assigned EC number0.68290.61300.1002yesN/A
Q54SA7SF3B3_DICDINo assigned EC number0.57720.58290.0923yesN/A
P0CR22RSE1_CRYNJNo assigned EC number0.54470.61300.1002yesN/A
Q5RBI5SF3B3_PONABNo assigned EC number0.68290.61300.1002yesN/A
Q4WLI5RSE1_ASPFUNo assigned EC number0.51210.61800.1004yesN/A
A0JN52SF3B3_BOVINNo assigned EC number0.68290.61300.1002yesN/A
Q15393SF3B3_HUMANNo assigned EC number0.68290.61300.1002yesN/A
Q1LVE8SF3B3_DANRENo assigned EC number0.69910.61800.1010yesN/A
Q5B1X8RSE1_EMENINo assigned EC number0.52030.61800.1017yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
pfam03178 318 pfam03178, CPSF_A, CPSF A subunit region 3e-44
pfam03178318 pfam03178, CPSF_A, CPSF A subunit region 4e-17
>gnl|CDD|217409 pfam03178, CPSF_A, CPSF A subunit region Back     alignment and domain information
 Score =  149 bits (378), Expect = 3e-44
 Identities = 54/121 (44%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 75  MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESM 134
           ++ VHKT V     A+C FQG LL G G+ LR+YDLGK KLL K         +V ++  
Sbjct: 77  LKLVHKTEVKGAVTALCEFQGRLLAGQGQKLRVYDLGKDKLLPKAFLDTPITYVVSLKVF 136

Query: 135 GHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVL-DYNTVASADKFGNVCI 193
           G+RI V D+ +SV  + Y     +L++FA DTQPRW+T +  L DY+T+  ADKFGN+ +
Sbjct: 137 GNRIIVGDLMKSVTFLGYDEEPYRLILFARDTQPRWVTAAEFLVDYDTILGADKFGNLHV 196

Query: 194 V 194
           +
Sbjct: 197 L 197


This family includes a region that lies towards the C-terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit. CPSF is involved in mRNA polyadenylation and binds the AAUAAA conserved sequence in pre-mRNA. CPSF has also been found to be necessary for splicing of single-intron pre-mRNAs. The function of the aligned region is unknown but may be involved in RNA/DNA binding. Length = 318

>gnl|CDD|217409 pfam03178, CPSF_A, CPSF A subunit region Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
KOG1897|consensus 1096 99.97
KOG1898|consensus 1205 99.97
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 99.96
KOG1896|consensus 1366 99.86
KOG1898|consensus1205 99.85
COG5161 1319 SFT1 Pre-mRNA cleavage and polyadenylation specifi 99.57
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 99.42
KOG1897|consensus 1096 99.32
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.39
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.11
KOG1036|consensus 323 96.92
KOG1539|consensus 910 96.54
PLN00181793 protein SPA1-RELATED; Provisional 96.32
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.07
PLN00181 793 protein SPA1-RELATED; Provisional 95.99
KOG2106|consensus 626 95.97
KOG0646|consensus 476 95.89
PRK11028330 6-phosphogluconolactonase; Provisional 95.85
KOG0291|consensus 893 95.75
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 95.55
KOG0318|consensus603 95.46
KOG1896|consensus 1366 95.35
KOG4378|consensus 673 95.15
KOG1408|consensus 1080 94.9
KOG1188|consensus 376 94.64
KOG1539|consensus 910 94.56
KOG0278|consensus334 94.26
PTZ00420 568 coronin; Provisional 94.2
KOG2111|consensus346 93.94
KOG0283|consensus 712 93.38
KOG0315|consensus311 92.88
KOG2106|consensus 626 92.79
PTZ00421 493 coronin; Provisional 92.45
KOG0315|consensus 311 92.35
KOG0296|consensus 399 91.61
KOG2394|consensus 636 90.91
KOG1273|consensus 405 90.79
KOG0268|consensus 433 90.5
KOG0291|consensus 893 90.38
KOG0318|consensus603 90.31
PRK11028330 6-phosphogluconolactonase; Provisional 89.08
KOG2048|consensus 691 88.49
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 88.44
KOG0771|consensus398 87.63
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 87.37
KOG0306|consensus 888 86.68
KOG0279|consensus 315 86.64
KOG3881|consensus412 86.62
KOG0305|consensus484 86.54
KOG0273|consensus 524 86.48
KOG0299|consensus 479 86.38
KOG0646|consensus 476 86.2
KOG0306|consensus 888 85.53
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.35
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 84.76
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 84.62
KOG0274|consensus 537 84.49
KOG0266|consensus 456 84.36
KOG0650|consensus733 84.12
KOG2110|consensus391 83.8
KOG2048|consensus 691 83.78
KOG0647|consensus 347 83.63
KOG0647|consensus 347 83.46
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 83.32
KOG0310|consensus 487 82.17
KOG1036|consensus323 81.73
KOG0772|consensus 641 81.67
KOG0289|consensus506 81.48
KOG2055|consensus 514 81.46
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 81.24
KOG0282|consensus503 80.93
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 80.84
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 80.14
>KOG1897|consensus Back     alignment and domain information
Probab=99.97  E-value=2.6e-31  Score=255.13  Aligned_cols=171  Identities=28%  Similarity=0.431  Sum_probs=143.5

Q ss_pred             ceeEEecCCCcceeeccc--------CCEEEEeecCeeEEEecchhhhhhhhhhcccccCceeeeeEEEEEcCceeEE--
Q psy17021          2 EFVHKTSVDEVPYAMCPF--------QGALLVGVGRYLRLYDLGKKKLLRKCENKVRIKGFRKAHQTHTHSGRSDRLV--   71 (199)
Q Consensus         2 ~~~h~t~~~~~~~~~~~f--------~~~ll~~~~~~l~~y~~g~k~ll~k~~~~~~~~~~~~~~~~~~~~~~~ri~v--   71 (199)
                      +.+|-++.++.-.|+.--        +.+++||.|.   +|+       .|.|.+                 .+||.+  
T Consensus       761 ~vl~~hef~~~E~~~Si~s~~~~~d~~t~~vVGT~~---v~P-------de~ep~-----------------~GRIivfe  813 (1096)
T KOG1897|consen  761 EVLSSHEFERNETALSIISCKFTDDPNTYYVVGTGL---VYP-------DENEPV-----------------NGRIIVFE  813 (1096)
T ss_pred             eEEeeccccccceeeeeeeeeecCCCceEEEEEEEe---ecc-------CCCCcc-----------------cceEEEEE
Confidence            567777777655544333        5568899876   555       222322                 245532  


Q ss_pred             ---CCeeeEEEeeccCCcceEEccccCeEEEEeCCEEEEEEcCCcceeeeeeccCcCceEEEEEEeCCEEEEEeccccEE
Q psy17021         72 ---GNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLIVKIESMGHRIYVSDVQESVF  148 (199)
Q Consensus        72 ---gdklesVh~~~~kG~v~aL~~f~g~LLaavg~~v~vy~l~~~~Ll~~~~~~~~~~~i~~l~~~~~~IlVGD~~~Sv~  148 (199)
                         +.+++.+|+++++|+|++++.|+|++|||+|++|++|+|+.++.+++++....|+++.+|++.||+|+|||+|+|++
T Consensus       814 ~~e~~~L~~v~e~~v~Gav~aL~~fngkllA~In~~vrLye~t~~~eLr~e~~~~~~~~aL~l~v~gdeI~VgDlm~Sit  893 (1096)
T KOG1897|consen  814 FEELNSLELVAETVVKGAVYALVEFNGKLLAGINQSVRLYEWTTERELRIECNISNPIIALDLQVKGDEIAVGDLMRSIT  893 (1096)
T ss_pred             EecCCceeeeeeeeeccceeehhhhCCeEEEecCcEEEEEEccccceehhhhcccCCeEEEEEEecCcEEEEeeccceEE
Confidence               47899999999999999999999999999999999999998854454444448999999999999999999999999


Q ss_pred             EEEEeCCCCeEEEEeccCCceeEEEEEEEeCCeEEEEcCCCcEEEEeecCC
Q psy17021        149 LVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE  199 (199)
Q Consensus       149 ll~y~~~~~~l~~varD~~~~wvta~~~Ld~~t~l~aD~~gNl~vlr~~~~  199 (199)
                      +++|+.++++|+|+|||++|+|+||+|++|+++|+|||++||+|++|+|.+
T Consensus       894 ll~y~~~eg~f~evArD~~p~Wmtaveil~~d~ylgae~~gNlf~v~~d~~  944 (1096)
T KOG1897|consen  894 LLQYKGDEGNFEEVARDYNPNWMTAVEILDDDTYLGAENSGNLFTVRKDSD  944 (1096)
T ss_pred             EEEEeccCCceEEeehhhCccceeeEEEecCceEEeecccccEEEEEecCC
Confidence            999999999999999999999999999999999999999999999999864



>KOG1898|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>COG5161 SFT1 Pre-mRNA cleavage and polyadenylation specificity factor [RNA processing and modification] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
3ei1_A 1158 Structure Of Hsddb1-Drddb2 Bound To A 14 Bp 6-4 Pho 3e-08
4a0a_A 1159 Structure Of Hsddb1-Drddb2 Bound To A 16 Bp Cpd-Dup 3e-08
4a08_A 1159 Structure Of Hsddb1-Drddb2 Bound To A 13 Bp Cpd-Dup 3e-08
4a0b_A 1159 Structure Of Hsddb1-Drddb2 Bound To A 16 Bp Cpd-Dup 3e-08
3e0c_A 1140 Crystal Structure Of Dna Damage-Binding Protein 1(D 3e-08
4e54_A 1150 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 3e-08
4a11_A 1159 Structure Of The Hsddb1-Hscsa Complex Length = 1159 3e-08
4a0l_A 1144 Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp 3e-08
3ei4_A 1158 Structure Of The Hsddb1-Hsddb2 Complex Length = 115 9e-08
3i7h_A 1143 Crystal Structure Of Ddb1 In Complex With The H-Box 9e-08
2b5l_A 1140 Crystal Structure Of Ddb1 In Complex With Simian Vi 9e-08
>pdb|3EI1|A Chain A, Structure Of Hsddb1-Drddb2 Bound To A 14 Bp 6-4 Photoproduct Containing Dna-Duplex Length = 1158 Back     alignment and structure

Iteration: 1

Score = 55.1 bits (131), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 2/120 (1%) Query: 75 MEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLI-VKIES 133 ++ V + V Y+M F G LL + +RLY+ +K LR E H N++ + +++ Sbjct: 876 LQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR-TECNHYNNIMALYLKT 934 Query: 134 MGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCI 193 G I V D+ SV L+ YK E A D P W++ +LD + A+ N+ + Sbjct: 935 KGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFV 994
>pdb|4A0A|A Chain A, Structure Of Hsddb1-Drddb2 Bound To A 16 Bp Cpd-Duplex ( Pyrimidine At D-1 Position) At 3.6 A Resolution (Cpd 3) Length = 1159 Back     alignment and structure
>pdb|4A08|A Chain A, Structure Of Hsddb1-Drddb2 Bound To A 13 Bp Cpd-Duplex ( Purine At D-1 Position) At 3.0 A Resolution (Cpd 1) Length = 1159 Back     alignment and structure
>pdb|4A0B|A Chain A, Structure Of Hsddb1-Drddb2 Bound To A 16 Bp Cpd-Duplex ( Pyrimidine At D-1 Position) At 3.8 A Resolution (Cpd 4) Length = 1159 Back     alignment and structure
>pdb|3E0C|A Chain A, Crystal Structure Of Dna Damage-Binding Protein 1(Ddb1) Length = 1140 Back     alignment and structure
>pdb|4E54|A Chain A, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 1150 Back     alignment and structure
>pdb|4A11|A Chain A, Structure Of The Hsddb1-Hscsa Complex Length = 1159 Back     alignment and structure
>pdb|4A0L|A Chain A, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 1144 Back     alignment and structure
>pdb|3EI4|A Chain A, Structure Of The Hsddb1-Hsddb2 Complex Length = 1158 Back     alignment and structure
>pdb|3I7H|A Chain A, Crystal Structure Of Ddb1 In Complex With The H-Box Motif Of Hbx Length = 1143 Back     alignment and structure
>pdb|2B5L|A Chain A, Crystal Structure Of Ddb1 In Complex With Simian Virus 5 V Protein Length = 1140 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 2e-36
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 4e-11
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Length = 1158 Back     alignment and structure
 Score =  133 bits (336), Expect = 2e-36
 Identities = 33/127 (25%), Positives = 57/127 (44%)

Query: 69  RLVGNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHLPNLI 128
           +     ++ V +  V    Y+M  F G LL  +   +RLY+   +K LR   N +   + 
Sbjct: 870 QYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMA 929

Query: 129 VKIESMGHRIYVSDVQESVFLVRYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKF 188
           + +++ G  I V D+  SV L+ YK  E      A D  P W++   +LD +    A+  
Sbjct: 930 LYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENA 989

Query: 189 GNVCIVS 195
            N+ +  
Sbjct: 990 FNLFVCQ 996


>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Length = 1158 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 99.96
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 99.55
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.87
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.74
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.7
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.64
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.56
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.48
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.4
3jrp_A379 Fusion protein of protein transport protein SEC13 97.39
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.37
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.37
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.34
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.33
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.33
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.32
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.31
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.3
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.26
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.24
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.18
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.15
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.14
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 97.05
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.04
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.03
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.99
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.98
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 96.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.93
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.92
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.91
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.91
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.91
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.88
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 96.87
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.86
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.81
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.81
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.8
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.79
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 96.77
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 96.77
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.72
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.66
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.61
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.59
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.58
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.58
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.58
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.57
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.57
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.53
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 96.48
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.47
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.43
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 96.38
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.28
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 96.27
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.27
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.26
2pm7_B297 Protein transport protein SEC13, protein transport 96.23
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.23
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.2
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.2
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.18
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.16
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.12
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.09
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 96.04
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.98
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 95.97
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.89
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 95.88
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.86
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.81
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.78
3jro_A 753 Fusion protein of protein transport protein SEC13 95.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.7
3jro_A 753 Fusion protein of protein transport protein SEC13 95.66
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.66
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 95.62
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.61
2ymu_A577 WD-40 repeat protein; unknown function, two domain 95.6
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.5
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 95.47
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.45
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.41
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.4
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 95.39
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.38
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.34
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.25
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 95.23
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.14
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.03
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.02
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.0
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 94.89
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 94.87
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 94.79
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.74
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 94.67
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 94.45
2pm7_B297 Protein transport protein SEC13, protein transport 94.43
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.4
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.38
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.35
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.32
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 94.13
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 93.98
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 93.97
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 93.69
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 93.69
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 93.68
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 93.54
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 93.47
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 93.43
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.39
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 93.06
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.04
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.0
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 92.77
3v9f_A 781 Two-component system sensor histidine kinase/RESP 92.61
2ymu_A577 WD-40 repeat protein; unknown function, two domain 92.6
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.55
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 92.4
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 92.36
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 91.63
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.55
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 91.55
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 91.46
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 91.2
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 91.1
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 90.96
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 90.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 90.44
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 90.38
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 89.73
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 89.39
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 89.26
2fp8_A322 Strictosidine synthase; six bladed beta propeller 88.98
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 88.74
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 87.94
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 87.66
4a2l_A 795 BT_4663, two-component system sensor histidine kin 87.38
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 87.32
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 86.71
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 86.57
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 86.5
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 85.78
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 85.34
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 85.3
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 85.28
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 84.91
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 83.53
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 83.52
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 83.13
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 82.74
2p4o_A 306 Hypothetical protein; putative lactonase, structur 82.2
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 81.64
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 81.14
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 81.01
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 80.82
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 80.47
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
Probab=99.96  E-value=2.2e-28  Score=244.36  Aligned_cols=127  Identities=27%  Similarity=0.445  Sum_probs=116.6

Q ss_pred             CCeeeEEEeeccCCcceEEccccCeEEEEeCCEEEEEEcCCcceeeeeeccCc-CceEEEEEEeCCEEEEEeccccEEEE
Q psy17021         72 GNAMEFVHKTSVDEVPYAMCPFQGALLVGVGRYLRLYDLGKKKLLRKCENKHL-PNLIVKIESMGHRIYVSDVQESVFLV  150 (199)
Q Consensus        72 gdklesVh~~~~kG~v~aL~~f~g~LLaavg~~v~vy~l~~~~Ll~~~~~~~~-~~~i~~l~~~~~~IlVGD~~~Sv~ll  150 (199)
                      +.+++.+|.++++|+|+|+++|+|+||||+|++|++|+|+++++++ ++...+ +..++++++.+|+|+|||+|+||+|+
T Consensus       873 ~~kL~lv~~~~v~g~v~al~~~~g~Lla~ig~~l~vy~l~~~~~L~-~~~~~~~~i~~~~l~~~~~~I~vgD~~~Sv~~~  951 (1158)
T 3ei3_A          873 DGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR-TECNHYNNIMALYLKTKGDFILVGDLMRSVLLL  951 (1158)
T ss_dssp             TTEEEEEEEEEESSCEEEEEEETTEEEEEETTEEEEEEECTTSCEE-EEEEECCCSCEEEEEEETTEEEEEESSBCEEEE
T ss_pred             CCEEEEEEEEEcCCcCEEEeeeCCEEEEEcCCEEEEEECCCCceEE-EEeeccccEEEEEEeccCCEEEEEEhhheEEEE
Confidence            5699999999999999999999999999999999999999887666 333212 23477999999999999999999999


Q ss_pred             EEeCCCCeEEEEeccCCceeEEEEEEEeCCeEEEEcCCCcEEEEeecCC
Q psy17021        151 RYKRYENQLLIFADDTQPRWITTSCVLDYNTVASADKFGNVCIVSTYRE  199 (199)
Q Consensus       151 ~y~~~~~~l~~varD~~~~wvta~~~Ld~~t~l~aD~~gNl~vlr~~~~  199 (199)
                      +|++++++|+++|||+.|+|+||+++||++++++||++|||+++|+||+
T Consensus       952 ~y~~~~~~L~~~a~D~~~~~vta~~~ld~~t~l~aD~~gNl~vl~~~~~ 1000 (1158)
T 3ei3_A          952 AYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSA 1000 (1158)
T ss_dssp             EEETTTTEEEEEEECCSCBCEEEEEEEETTEEEEEETTSEEEEEEECTT
T ss_pred             EEEcCCCeEEEEEeecccccEEEEEEEccCcEEEEcCCCcEEEEecCCC
Confidence            9999999999999999999999999999999999999999999999985



>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.73
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.6
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.29
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.23
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.21
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.14
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 96.88
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.8
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.6
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.48
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.37
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.28
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.03
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 95.99
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.78
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.71
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.71
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.39
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.49
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.36
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.14
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.75
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.15
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 92.02
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 91.79
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 91.74
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 88.24
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 87.15
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 85.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 85.64
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 83.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 83.29
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 82.36
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=97.73  E-value=0.0043  Score=47.78  Aligned_cols=177  Identities=13%  Similarity=0.068  Sum_probs=99.5

Q ss_pred             ccCCEEEEeecCeeEEEecchhhhhhhhhhcc--c-ccCceeeeeEEEEEcCceeEE----CCeeeEEEeeccCCcceEE
Q psy17021         18 PFQGALLVGVGRYLRLYDLGKKKLLRKCENKV--R-IKGFRKAHQTHTHSGRSDRLV----GNAMEFVHKTSVDEVPYAM   90 (199)
Q Consensus        18 ~f~~~ll~~~~~~l~~y~~g~k~ll~k~~~~~--~-~~~~~~~~~~~~~~~~~ri~v----gdklesVh~~~~kG~v~aL   90 (199)
                      +-...+.++..+.+++|+.++..-+.......  . .|.. . .+..- ..++.+.+    +.+...+.....+++++++
T Consensus       109 ~~g~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~s~~~-~-~l~~g-~~dg~i~~~d~~~~~~~~~~~~~~~~~i~~~  185 (299)
T d1nr0a2         109 ADGDIAVAACYKHIAIYSHGKLTEVPISYNSSCVALSNDK-Q-FVAVG-GQDSKVHVYKLSGASVSEVKTIVHPAEITSV  185 (299)
T ss_dssp             TTSSCEEEEESSEEEEEETTEEEEEECSSCEEEEEECTTS-C-EEEEE-ETTSEEEEEEEETTEEEEEEEEECSSCEEEE
T ss_pred             cccccccccccccccccccccccccccccccccccccccc-c-ccccc-ccccccccccccccccccccccccccccccc
Confidence            43445667777999999987643221111100  0 0100 0 01110 11122221    2333444445567788887


Q ss_pred             ccc-cCe-EEEEe-CCEEEEEEcCCcceee-eeeccCcCceEEEEEE--eCCEEEEEeccccEEEEEEeCCCCeEEEEec
Q psy17021         91 CPF-QGA-LLVGV-GRYLRLYDLGKKKLLR-KCENKHLPNLIVKIES--MGHRIYVSDVQESVFLVRYKRYENQLLIFAD  164 (199)
Q Consensus        91 ~~f-~g~-LLaav-g~~v~vy~l~~~~Ll~-~~~~~~~~~~i~~l~~--~~~~IlVGD~~~Sv~ll~y~~~~~~l~~var  164 (199)
                      ..- ++. |+++- +.++++|++...+... ......-...+.++..  .+++++.|..-.++.++..+...........
T Consensus       186 ~~~~~~~~l~~~~~d~~i~~~~~~~~~~~~~~~~~~~h~~~v~~l~~s~~~~~l~sgs~dg~i~iwd~~~~~~~~~~~~~  265 (299)
T d1nr0a2         186 AFSNNGAFLVATDQSRKVIPYSVANNFELAHTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVIVWNMNKPSDHPIIIKG  265 (299)
T ss_dssp             EECTTSSEEEEEETTSCEEEEEGGGTTEESCCCCCCCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTCTTSCCEEETT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccceEEEcCCCEEEEEECCCCCcceEEEec
Confidence            533 344 44443 5789999997554322 2222211234677664  5679999998888888766543333333334


Q ss_pred             cCCceeEEEEEEEeCCeEEEEcCCCcEEEEeec
Q psy17021        165 DTQPRWITTSCVLDYNTVASADKFGNVCIVSTY  197 (199)
Q Consensus       165 D~~~~wvta~~~Ld~~t~l~aD~~gNl~vlr~~  197 (199)
                      ......++++.+.|++.++.+-.+++|.+..+|
T Consensus       266 ~~~~~~v~~~~~~~~~~l~s~s~D~~i~iWdl~  298 (299)
T d1nr0a2         266 AHAMSSVNSVIWLNETTIVSAGQDSNIKFWNVP  298 (299)
T ss_dssp             SSTTSCEEEEEEEETTEEEEEETTSCEEEEECC
T ss_pred             CCCCCcEEEEEECCCCEEEEEeCCCEEEEEecc
Confidence            444556777778888899988899999998876



>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure