Diaphorina citri psyllid: psy17028

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MLIHYHPNLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNRYNHTSTYWSATHYQLDLIRCQVYLIDAQDQEAVLNELRHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEMPTRGSSLVRTAV
cccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccEEEEEEECccEEEEEcccccccccCEEcccEEEEEEcccccccccEEEEEccccEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccccccc
**IHYHPNLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNRYNHTSTYWSATHYQLDLIRCQVYLIDAQDQEAVLNELRHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVA*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIHYHPNLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNRYNHTSTYWSATHYQLDLIRCQVYLIDAQDQEAVLNELRHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEMPTRGSSLVRTAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein melted Participates in fat metabolism regulation by recruiting FOXO and the TSC1-TSC2 complex to the cell membrane, which positively regulates TOR activity and negatively regulates the expression of FOXO target genes. Involved in R8 photoreceptor subtype specification. During early embryonic development, may be required for ectodermal patterning.confidentQ9VS24

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010314 [MF]phosphatidylinositol-5-phosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TFM, chain A
Confidence level:very confident
Coverage over the Query: 180-316
View the alignment between query and template
View the model in PyMOL
Template: 3TJZ, chain B
Confidence level:probable
Coverage over the Query: 12-79,96-118
View the alignment between query and template
View the model in PyMOL