Psyllid ID: psy17028

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----

MLIHYHPNLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNRYNHTSTYWSATHYQLDLIRCQVYLIDAQDQEAVLNELRHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEMPTRGSSLVRTAV

cccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccEEEEEEEEccEEEEEcccccccccEEEcccEEEEEEcccccccccEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccc

ccEEcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEHHcccccHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEEcccccccEEEccccccEEEcccHccccHHHHHHHHcHEEEEEcccEEEEEcccccccccccEHccEEEEEEcccccccccEEEEEccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccEEEEccc

mlihyhpnlcggYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPklkqanegnantLCVTVQVVAAVGRLNKDKAQDALNFILAHlpkadrssqSVLLREATLLCstypvlctdKMLAEVWQCsrnrynhtstywsATHYQLDLIRCQVYLIDAQDQEAVLNELrhsgfcdvfeygvsgggkeaswgcflcnhperavgflqdshpviegqLKEKKGRWKIFKRWRTRYFtlsgahlsykgskedkqetpidvhrirsvkvsrgarnipkafeiftgddslilkpkngknaEQWVQCLSVVVAHsqakemptrgsslvrtav

MLIHYHPNLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDALNFILAHlpkadrssqSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNRYNHTSTYWSATHYQLDLIRCQVYLIDAQDQEAVLNELRHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDSHPViegqlkekkgrwkIFKRWRTRyftlsgahlsykgskedkqetpidvhrirsvkvsrgarnipkafeiftgddsLILKPKNGKNAEQWVQCLSVVVAHsqakemptrgsslvrtav

**IHYHPNLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNRYNHTSTYWSATHYQLDLIRCQVYLIDAQDQEAVLNELRHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSY*************VHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVA*******************

*******NLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAA***********ALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVW********************L**********************RHSGFCDVFEYGVSGGGKEASWGCFLCNHP***********PVIEGQLK**KGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSV**********************

MLIHYHPNLCGGYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDALNFILAHLPKADRSSQSVLLREATLLCSTYPVLCTDKMLAEVWQCSRNRYNHTSTYWSATHYQLDLIRCQVYLIDAQDQEAVLNELRHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSY**********PIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQ****************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		334	2.2.26 [Sep-21-2011]
Q9VS24		994	Protein melted OS=Drosoph	yes	N/A	0.464	0.155	0.678	7e-62
Q5PQS3		832	Ventricular zone-expresse	yes	N/A	0.431	0.173	0.464	1e-35
Q14D04		833	Ventricular zone-expresse	no	N/A	0.458	0.183	0.463	3e-35
A1A535		833	Ventricular zone-expresse	yes	N/A	0.458	0.183	0.451	1e-34
A2BID5		813	Ventricular zone-expresse	yes	N/A	0.619	0.254	0.366	3e-33
Q61QK6		867	Protein melted homolog OS	N/A	N/A	0.449	0.173	0.418	1e-28
O17237		871	Protein melted homolog OS	yes	N/A	0.449	0.172	0.412	3e-28
Q9Z268		799	RasGAP-activating-like pr	no	N/A	0.335	0.140	0.322	0.0007

>sp\|Q9VS24\|MELT_DROME Protein melted OS=Drosophila melanogaster GN=melt PE=1 SV=2	Back alignment and function desciption

 Score =  237 bits (605), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 112/165 (67%), Positives = 134/165 (81%), Gaps = 10/165 (6%)

Query: 167 QDQEAVLNELRHSGFCDVFEYGVSGGGK------EASWGCFLCNHPERAVGFLQDSH-PV 219
           +D+E ++NELRHSGF DVFE   +          E  WGCFLCNHP++AVGFL  S+ P+
Sbjct: 815 KDREILVNELRHSGFLDVFEVSKTDKSNPNCNELEYQWGCFLCNHPDKAVGFLNGSNQPM 874

Query: 220 IEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARN 279
           IEGQLKEKKG+W++F+RWRTRYFTLSGAHLS KGS   +    IDV++IRSVKVSRGARN
Sbjct: 875 IEGQLKEKKGKWRLFRRWRTRYFTLSGAHLSCKGSSGGES---IDVNQIRSVKVSRGARN 931

Query: 280 IPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEMPT 324
           IPKAFEIFT D +LILKPK+GKNAE+WVQCLS+VVAHSQA++ PT
Sbjct: 932 IPKAFEIFTADQTLILKPKDGKNAEEWVQCLSIVVAHSQARDNPT 976

Participates in fat metabolism regulation by recruiting FOXO and the TSC1-TSC2 complex to the cell membrane, which positively regulates TOR activity and negatively regulates the expression of FOXO target genes. Involved in R8 photoreceptor subtype specification. During early embryonic development, may be required for ectodermal patterning.
Drosophila melanogaster (taxid: 7227)

>sp\|Q5PQS3\|MELT_RAT Ventricular zone-expressed PH domain-containing protein homolog 1 OS=Rattus norvegicus GN=Veph1 PE=2 SV=1	Back alignment and function description

>sp\|Q14D04\|MELT_HUMAN Ventricular zone-expressed PH domain-containing protein homolog 1 OS=Homo sapiens GN=VEPH1 PE=2 SV=1	Back alignment and function description

>sp\|A1A535\|MELT_MOUSE Ventricular zone-expressed PH domain-containing protein 1 OS=Mus musculus GN=Veph1 PE=2 SV=2	Back alignment and function description

>sp\|A2BID5\|MELT_DANRE Ventricular zone-expressed PH domain-containing protein OS=Danio rerio GN=veph PE=2 SV=1	Back alignment and function description

>sp\|Q61QK6\|MELT_CAEBR Protein melted homolog OS=Caenorhabditis briggsae GN=CBG06982 PE=3 SV=2	Back alignment and function description

>sp\|O17237\|MELT_CAEEL Protein melted homolog OS=Caenorhabditis elegans GN=K10B4.3 PE=3 SV=3	Back alignment and function description

>sp\|Q9Z268\|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		334
328712710		880	PREDICTED: protein melted-like isoform 1	0.491	0.186	0.782	2e-74
328712712		867	PREDICTED: protein melted-like isoform 2	0.491	0.189	0.782	2e-74
242011553		934	conserved hypothetical protein [Pediculu	0.485	0.173	0.786	3e-71
195160403		991	GL25030 [Drosophila persimilis] gi\|19411	0.464	0.156	0.678	7e-61
198464703		991	GA21215 [Drosophila pseudoobscura pseudo	0.464	0.156	0.678	8e-61
195428771		1023	GK16654 [Drosophila willistoni] gi\|19415	0.592	0.193	0.533	3e-60
194747221		984	GF25012 [Drosophila ananassae] gi\|190623	0.464	0.157	0.678	3e-60
195376861		1010	GJ12062 [Drosophila virilis] gi\|19415436	0.464	0.153	0.678	3e-60
195021491		1013	GH14519 [Drosophila grimshawi] gi\|193898	0.464	0.153	0.678	3e-60
195588382		968	GD13996 [Drosophila simulans] gi\|1941959	0.464	0.160	0.678	3e-60

>gi\|328712710\|ref\|XP_001944371.2\| PREDICTED: protein melted-like isoform 1 [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (88%), Gaps = 6/170 (3%)

Query: 167 QDQEAVLNELRHSGFCDVFEY-GVSGGGKEASWGCFLCNHPERAVGFLQDSHPVIEGQLK 225
           +DQ+AVLNELR+SG+ DVFE+  ++ GG    WGCFLCNHPERAVGFLQDS PVIEGQLK
Sbjct: 715 KDQDAVLNELRNSGYFDVFEHCNINAGG----WGCFLCNHPERAVGFLQDSQPVIEGQLK 770

Query: 226 EKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARNIPKAFE 285
           EKKGRW+IFKRWRTRYFTLSGAHLSYKGSK DK  TPID+H+IRSVKVSRGARNIPKAFE
Sbjct: 771 EKKGRWRIFKRWRTRYFTLSGAHLSYKGSKNDKDGTPIDIHQIRSVKVSRGARNIPKAFE 830

Query: 286 IFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEMP-TRGSSLVRTAV 334
           IFTG++SLILKPK GKNAE+WVQCLSVVVAHS +K+   +R SSL+RT +
Sbjct: 831 IFTGEESLILKPKGGKNAEEWVQCLSVVVAHSHSKDTTNSRNSSLIRTTI 880

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|328712712\|ref\|XP_003244886.1\| PREDICTED: protein melted-like isoform 2 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|242011553\|ref\|XP_002426513.1\| conserved hypothetical protein [Pediculus humanus corporis] gi\|212510639\|gb\|EEB13775.1\| conserved hypothetical protein [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|195160403\|ref\|XP_002021065.1\| GL25030 [Drosophila persimilis] gi\|194118178\|gb\|EDW40221.1\| GL25030 [Drosophila persimilis]	Back alignment and taxonomy information

>gi\|198464703\|ref\|XP_001353335.2\| GA21215 [Drosophila pseudoobscura pseudoobscura] gi\|198149839\|gb\|EAL30838.2\| GA21215 [Drosophila pseudoobscura pseudoobscura]	Back alignment and taxonomy information

>gi\|195428771\|ref\|XP_002062439.1\| GK16654 [Drosophila willistoni] gi\|194158524\|gb\|EDW73425.1\| GK16654 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|194747221\|ref\|XP_001956051.1\| GF25012 [Drosophila ananassae] gi\|190623333\|gb\|EDV38857.1\| GF25012 [Drosophila ananassae]	Back alignment and taxonomy information

>gi\|195376861\|ref\|XP_002047211.1\| GJ12062 [Drosophila virilis] gi\|194154369\|gb\|EDW69553.1\| GJ12062 [Drosophila virilis]	Back alignment and taxonomy information

>gi\|195021491\|ref\|XP_001985404.1\| GH14519 [Drosophila grimshawi] gi\|193898886\|gb\|EDV97752.1\| GH14519 [Drosophila grimshawi]	Back alignment and taxonomy information

>gi\|195588382\|ref\|XP_002083937.1\| GD13996 [Drosophila simulans] gi\|194195946\|gb\|EDX09522.1\| GD13996 [Drosophila simulans]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		334
FB\|FBgn0023001		994	melt "melted" [Drosophila mela	0.464	0.155	0.678	7.4e-78
UNIPROTKB\|F1MPJ3		791	VEPH1 "Uncharacterized protein	0.458	0.193	0.481	6.9e-43
UNIPROTKB\|F1SJM1		792	VEPH1 "Uncharacterized protein	0.458	0.193	0.475	1e-41
UNIPROTKB\|Q14D04		833	VEPH1 "Ventricular zone-expres	0.458	0.183	0.463	2.1e-40
UNIPROTKB\|F1Q407		833	VEPH1 "Uncharacterized protein	0.458	0.183	0.463	2.6e-40
RGD\|1308217		832	Veph1 "ventricular zone expres	0.455	0.182	0.448	3.1e-39
UNIPROTKB\|E1C9E4		832	VEPH1 "Uncharacterized protein	0.458	0.183	0.457	5.1e-39
MGI\|MGI:1920039		833	Veph1 "ventricular zone expres	0.458	0.183	0.451	5.8e-38
ZFIN\|ZDB-GENE-041014-375		813	veph "ventricular zone express	0.610	0.250	0.376	2.4e-37
WB\|WBGene00019615		871	K10B4.3 [Caenorhabditis elegan	0.449	0.172	0.424	2.2e-34

FB\|FBgn0023001 melt "melted" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 580 (209.2 bits), Expect = 7.4e-78, Sum P(2) = 7.4e-78
 Identities = 112/165 (67%), Positives = 134/165 (81%)

Query:   167 QDQEAVLNELRHSGFCDVFEYGVSGGGK------EASWGCFLCNHPERAVGFLQDSH-PV 219
             +D+E ++NELRHSGF DVFE   +          E  WGCFLCNHP++AVGFL  S+ P+
Sbjct:   815 KDREILVNELRHSGFLDVFEVSKTDKSNPNCNELEYQWGCFLCNHPDKAVGFLNGSNQPM 874

Query:   220 IEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSVKVSRGARN 279
             IEGQLKEKKG+W++F+RWRTRYFTLSGAHLS KGS   +    IDV++IRSVKVSRGARN
Sbjct:   875 IEGQLKEKKGKWRLFRRWRTRYFTLSGAHLSCKGSSGGES---IDVNQIRSVKVSRGARN 931

Query:   280 IPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEMPT 324
             IPKAFEIFT D +LILKPK+GKNAE+WVQCLS+VVAHSQA++ PT
Sbjct:   932 IPKAFEIFTADQTLILKPKDGKNAEEWVQCLSIVVAHSQARDNPT 976

GO:0007422 "peripheral nervous system development" evidence=IMP

GO:0007398 "ectoderm development" evidence=IEP

GO:0045464 "R8 cell fate specification" evidence=IMP

GO:0030730 "sequestering of triglyceride" evidence=IMP

GO:0010314 "phosphatidylinositol-5-phosphate binding" evidence=IDA

GO:0008286 "insulin receptor signaling pathway" evidence=IMP

GO:0035091 "phosphatidylinositol binding" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:2001020 "regulation of response to DNA damage stimulus" evidence=IGI

UNIPROTKB\|F1MPJ3 VEPH1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SJM1 VEPH1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14D04 VEPH1 "Ventricular zone-expressed PH domain-containing protein homolog 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1Q407 VEPH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1308217 Veph1 "ventricular zone expressed PH domain-containing 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C9E4 VEPH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1920039 Veph1 "ventricular zone expressed PH domain-containing 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041014-375 veph "ventricular zone expressed PH domain protein" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

WB\|WBGene00019615 K10B4.3 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9VS24	MELT_DROME	No assigned EC number	0.6787	0.4640	0.1559	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		334
cd01264		110	cd01264, PH_MELT_VEPH1, Melted pleckstrin homology	4e-63
cd13276		117	cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin	1e-11
smart00233		102	smart00233, PH, Pleckstrin homology domain	2e-09
pfam00169		101	pfam00169, PH, PH domain	3e-09
cd01244		107	cd01244, PH_GAP1-like, RAS p21 protein activator (	4e-08
cd00821		92	cd00821, PH, Pleckstrin homology (PH) domain	5e-07
cd13255		110	cd13255, PH_TAAP2-like, Tandem PH-domain-containin	4e-06
cd13294		100	cd13294, PH_ORP_plant, Plant Oxysterol binding pro	1e-05
cd13369		138	cd13369, PH_RASAL1, Ras-GTPase-activating-like pro	7e-05
cd13250		98	cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin	2e-04
cd13316		95	cd13316, PH_Boi, Boi family Pleckstrin homology do	0.001
cd13274		97	cd13274, PH_DGK_type2, Type 2 Diacylglycerol kinas	0.001
cd01241		121	cd01241, PH_PKB, Protein Kinase B-like pleckstrin	0.001
cd10573		96	cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin	0.002
cd13298		106	cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin	0.002
cd13273		110	cd13273, PH_SWAP-70, Switch-associated protein-70	0.004

>gnl\|CDD\|241295 cd01264, PH_MELT_VEPH1, Melted pleckstrin homology (PH) domain	Back alignment and domain information

 Score =  195 bits (498), Expect = 4e-63
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 1/110 (0%)

Query: 212 FLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSYKGSKEDKQETPIDVHRIRSV 271
           FLQ+  PVIEGQLKEKKGRWK FKRWRTRYFTLSGA L Y+  K      PI++ +IRSV
Sbjct: 1   FLQEGQPVIEGQLKEKKGRWKFFKRWRTRYFTLSGASLLYRKLKSKDDSPPIELSKIRSV 60

Query: 272 KVS-RGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAK 320
           KV  R  R+IPKAFEIFT D + +LK K+GKNAE+WVQCLS+ VA + A+
Sbjct: 61  KVLRRRDRSIPKAFEIFTDDKTYVLKAKDGKNAEEWVQCLSIAVAQAHAR 110

The melted protein (also called Ventricular zone expressed PH domain-containing protein homolog 1) is expressed in the developing central nervous system of vertebrates. It contains a single C-terminal PH domain that is required for membrane targeting. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 110

>gnl\|CDD\|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain	Back alignment and domain information

>gnl\|CDD\|214574 smart00233, PH, Pleckstrin homology domain	Back alignment and domain information

>gnl\|CDD\|215766 pfam00169, PH, PH domain	Back alignment and domain information

>gnl\|CDD\|241277 cd01244, PH_GAP1-like, RAS p21 protein activator (GTPase activating protein) family pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241231 cd00821, PH, Pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241448 cd13294, PH_ORP_plant, Plant Oxysterol binding protein related protein Pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241520 cd13369, PH_RASAL1, Ras-GTPase-activating-like protein pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain	Back alignment and domain information

>gnl\|CDD\|241428 cd13274, PH_DGK_type2, Type 2 Diacylglycerol kinase Pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1	Back alignment and domain information

>gnl\|CDD\|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		334
KOG3723\|consensus		851		100.0
cd01264		101	PH_melted Melted pleckstrin homology (PH) domain.	99.93
cd01233		100	Unc104 Unc-104 pleckstrin homology (PH) domain. Un	99.88
cd01251		103	PH_centaurin_alpha Centaurin alpha Pleckstrin homo	99.88
cd01236		104	PH_outspread Outspread Pleckstrin homology (PH) do	99.86
cd01260		96	PH_CNK Connector enhancer of KSR (Kinase suppresso	99.86
cd01238		106	PH_Tec Tec pleckstrin homology (PH) domain. Tec pl	99.86
cd01235		101	PH_SETbf Set binding factor Pleckstrin Homology (P	99.85
cd01265		95	PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain	99.84
cd01266		108	PH_Gab Gab (Grb2-associated binder) pleckstrin hom	99.83
cd01257		101	PH_IRS Insulin receptor substrate (IRS) pleckstrin	99.83
cd01247		91	PH_GPBP Goodpasture antigen binding protein (GPBP)	99.82
cd01252		125	PH_cytohesin Cytohesin Pleckstrin homology (PH) do	99.81
cd01244		98	PH_RasGAP_CG9209 RAS_GTPase activating protein (GA	99.81
cd01250		94	PH_centaurin Centaurin Pleckstrin homology (PH) do	99.78
cd01246		91	PH_oxysterol_bp Oxysterol binding protein (OSBP) P	99.77
cd01241		102	PH_Akt Akt pleckstrin homology (PH) domain. Akt pl	99.76
cd01245		98	PH_RasGAP_CG5898 RAS GTPase-activating protein (GA	99.74
PF00169		104	PH: PH domain; InterPro: IPR001849 The pleckstrin	99.73
KOG0930\|consensus		395		99.66
cd01263		122	PH_anillin Anillin Pleckstrin homology (PH) domain	99.64
cd01254		121	PH_PLD Phospholipase D (PLD) pleckstrin homology (	99.63
cd01253		104	PH_beta_spectrin Beta-spectrin pleckstrin homology	99.62
cd01219		101	PH_FGD FGD (faciogenital dysplasia protein) plecks	99.6
PF15409		89	PH_8: Pleckstrin homology domain	99.55
cd01230		117	PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6	99.55
smart00233		102	PH Pleckstrin homology domain. Domain commonly fou	99.55
PF15413		112	PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE	99.52
cd01220		99	PH_CDEP Chondrocyte-derived ezrin-like domain cont	99.47
cd00821		96	PH Pleckstrin homology (PH) domain. Pleckstrin hom	99.45
cd00900		99	PH-like Pleckstrin homology-like domain. Pleckstri	99.39
cd01237		106	Unc112 Unc-112 pleckstrin homology (PH) domain. Un	99.37
PF14593		104	PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A.	99.33
PF15410		119	PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN	99.31
cd01256		110	PH_dynamin Dynamin pleckstrin homology (PH) domain	99.19
KOG1090\|consensus		1732		99.16
KOG0690\|consensus		516		99.15
cd01239		117	PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom	99.14
cd01218		104	PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain	99.04
cd01234		117	PH_CADPS CADPS (Ca2+-dependent activator protein)	99.03
KOG2059\|consensus		800		99.0
cd01242		112	PH_ROK Rok (Rho- associated kinase) pleckstrin hom	98.86
cd01262		89	PH_PDK1 3-Phosphoinositide dependent protein kinas	98.77
cd01243		122	PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin	98.73
cd01249		104	PH_oligophrenin Oligophrenin Pleckstrin homology (	98.73
KOG0521\|consensus		785		98.68
cd01259		114	PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr	98.63
cd01261		112	PH_SOS Son of Sevenless (SOS) Pleckstrin homology	98.58
KOG3640\|consensus		1116		98.5
PTZ00267		478	NIMA-related protein kinase; Provisional	98.42
cd01240		116	PH_beta-ARK Beta adrenergic receptor kinase 1(beta	98.39
cd01258		108	PH_syntrophin Syntrophin pleckstrin homology (PH)	98.32
KOG0248\|consensus		936		98.29
cd01222		97	PH_clg Clg (common-site lymphoma/leukemia guanine	98.05
KOG3751\|consensus		622		98.0
PF12814		123	Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin	97.96
PLN02866		1068	phospholipase D	97.85
PLN00188		719	enhanced disease resistance protein (EDR2); Provis	97.71
cd01226		100	PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin	97.69
PTZ00283		496	serine/threonine protein kinase; Provisional	97.66
KOG0932\|consensus		774		97.45
cd01224		109	PH_Collybistin Collybistin pleckstrin homology (PH	97.44
KOG1117\|consensus		1186		97.26
KOG1739\|consensus		611		97.24
KOG3723\|consensus		851		97.21
cd01225		111	PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-	97.12
cd01248		115	PH_PLC Phospholipase C (PLC) pleckstrin homology (	97.06
KOG0705\|consensus		749		97.06
cd01232		114	PH_TRIO Trio pleckstrin homology (PH) domain. Trio	97.03
KOG4424\|consensus		623		96.9
PF15406		112	PH_6: Pleckstrin homology domain	96.89
cd01221		125	PH_ephexin Ephexin Pleckstrin homology (PH) domain	96.89
KOG3543\|consensus		1218		96.51
KOG1451\|consensus		812		96.49
cd01228		96	PH_BCR-related BCR (breakpoint cluster region)-rel	96.48
PF15408		104	PH_7: Pleckstrin homology domain	96.41
KOG1117\|consensus		1186		96.19
cd01223		116	PH_Vav Vav pleckstrin homology (PH) domain. Vav pl	96.17
KOG3531\|consensus		1036		96.08
KOG4236\|consensus		888		96.07
cd01231		107	PH_Lnk LNK-family Pleckstrin homology (PH) domain.	95.61
KOG0248\|consensus		936		95.53
cd01227		133	PH_Dbs Dbs (DBL's big sister) pleckstrin homology	95.38
PF15404		185	PH_4: Pleckstrin homology domain	95.14
KOG0592\|consensus		604		94.22
KOG1737\|consensus		799		92.95
KOG4807\|consensus		593		92.77
KOG1738\|consensus		638		89.85
cd01255		160	PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM	89.73
KOG1170\|consensus		1099		89.47
PF08458		110	PH_2: Plant pleckstrin homology-like region; Inter	88.74
PF15411		116	PH_10: Pleckstrin homology domain	88.43
KOG1264\|consensus		1267		88.17
KOG4047\|consensus		429		87.8
cd05134		310	RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of	87.34
cd05394		313	RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the	86.9
cd05128		315	RasGAP_GAP1_like The GAP1 family of Ras GTPase-act	86.28
KOG3531\|consensus		1036		85.43
KOG3551\|consensus		506		84.54
KOG4424\|consensus		623		83.26
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	82.93
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	82.29
KOG3549\|consensus		505		82.13

>KOG3723\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.9e-57  Score=454.12  Aligned_cols=306  Identities=38%  Similarity=0.697  Sum_probs=264.9

Q ss_pred             hHHHHHhhHHHHHhhccCchhhHHHHHHHHHHhhcCCchhhhchHHHHHhhhcCchhHHHHHHHHHhhccCChhhHHHHH
Q psy17028         12 GYKLLEASLPQLCEYLATNSTILATMQIFLHLAEKRPQLLVDYVPKLKQANEGNANTLCVTVQVVAAVGRLNKDKAQDAL   91 (334)
Q Consensus        12 ~~~~l~~~vp~L~~~L~~~~~~~~~l~il~~ia~~~p~~l~~~l~~~k~~~~~~p~~~~~~aki~gavG~~~~~~a~~~L   91 (334)
                      -+|+|+.|||+|++.|.|+++++.+++|+.+||.+.|.++.+|+.+++++++++|++.+++|+|+.++|++|+++||.||
T Consensus       230 ~~evL~~ciP~L~g~l~ds~~~~i~~~Ilk~ia~~~pv~l~~~~E~l~e~~~~~p~~~~~~a~i~T~~g~~d~e~a~~~l  309 (851)
T KOG3723|consen  230 QLEVLQKCIPFLIGHLKDSTHNDIILNILKEIAVYEPVALNSFLEMLKEIGERFPYLTGQMARIYTAVGHVDEERARSCL  309 (851)
T ss_pred             cHHHHHHHHHHHHHHhccccchhHHHHHHHHHHhcCccchhhHHHHHHHHHHhCCCccHHHHHHHHHhcccchhhhcchH
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhCCCCcchhhhHHHHH-HHHhhccCCCcccccccceeecccc---------------------------------
Q psy17028         92 NFILAHLPKADRSSQSVLLRE-ATLLCSTYPVLCTDKMLAEVWQCSR---------------------------------  137 (334)
Q Consensus        92 ~~l~~~L~~~d~~~~~~Ll~E-i~~l~~~~p~ll~~~~~~~~r~~~~---------------------------------  137 (334)
                      +||++|+++++|+++|+|+.| |-+..+.+-+.++++ .|+.||+|+                                 
T Consensus       310 ~~l~~q~a~~~~s~~~~l~~eriLA~~~~~Ns~l~~q-~Di~~~~n~~S~i~SlNS~~~~n~~~~~Gr~~i~t~i~~p~~  388 (851)
T KOG3723|consen  310 TYLVSQLANMEHSFHHILLLERILAITDTFNSILGPQ-RDIFRMSNSFSAIASLNSRQLENTKAGSGRRKISTEIEFPEK  388 (851)
T ss_pred             HHHHHHHHHHHhcccHHHHHHHHHHHhCccccccchh-hHHHhhhhhHHHHHHhhccCcCCccCCCCcceeeecCCCCcc
Confidence            999999999999999999887 777888888888764 678887765                                 


Q ss_pred             -------------------ccc-------ccccc---------------------------c------------------
Q psy17028        138 -------------------NRY-------NHTST---------------------------Y------------------  146 (334)
Q Consensus       138 -------------------~r~-------~~~~~---------------------------~------------------  146 (334)
                                         +|.       -|++-                           .                  
T Consensus       389 l~e~~li~nT~~~~h~~~~~R~~~~~SR~~~ASntH~s~~r~hgpyS~g~~ske~~~iSn~~~nrsNv~la~~t~~ttkg  468 (851)
T KOG3723|consen  389 LEETKLIVNTENEDHEKLQVRIQAFESRINAASNTHGSIRRYHGPYSLGQVSKEERKISNIRFNRSNVSLAFHTMLTTKG  468 (851)
T ss_pred             hhhcccccCCCChHHHHHHhhhhhhhcccCccccccccccccccCcccccccHHHHhhcccccccccceEEeeccCcccc
Confidence                               111       11110                           0                  


Q ss_pred             --------c-----------------------------------------------------------------------
Q psy17028        147 --------W-----------------------------------------------------------------------  147 (334)
Q Consensus       147 --------~-----------------------------------------------------------------------  147 (334)
                              |                                                                       
T Consensus       469 ~~qs~~~af~~~nr~~Ip~~~s~s~VRP~gqGn~~~~~~td~~~~~~GS~s~T~P~~~H~~s~~ls~~~~~N~~~E~p~t  548 (851)
T KOG3723|consen  469 VGQSDDGAFEDENRGDIPASISLSEVRPLGQGNDKLPFKTDTERSQLGSSSVTYPNIIHIDSENLSETVKENSQEETPET  548 (851)
T ss_pred             cccCCCcccCcccccCcccccCccccccCCCCCccCccccchhhcccCcceeecccccccCCcchhHHHhhcccccCCcc
Confidence                    0                                                                       


Q ss_pred             cCCc--cc----------ccee---------------------------------eecc------c--------------
Q psy17028        148 SATH--YQ----------LDLI---------------------------------RCQV------Y--------------  162 (334)
Q Consensus       148 ~~~~--~~----------~~~i---------------------------------~c~~------~--------------  162 (334)
                      |...  ||          +.||                                 +||+      |              
T Consensus       549 N~~p~eyqd~Vy~F~Ekn~NkIk~Y~~EV~~~~PvP~qCtiE~S~rsK~vaklHFsCQ~RgP~ClysK~~F~~~T~~P~~  628 (851)
T KOG3723|consen  549 NASPIEYQDKVYLFLEKNLNKIKAYAMEVGKKIPVPDQCTIEDSVRSKCVAKLHFTCQLRGPYCLYSKSSFILITQEPQP  628 (851)
T ss_pred             CCCchhhHHHHHHHHHHhHHHHHHHHHHhcccCCCCceeeEecccccceEEEEEEEeecCCceeEeecceeeeeccCCch
Confidence            0000  22          1222                                 8887      2              


Q ss_pred             ------------------------------------------------------cCChhHHHHHHHHHhhcCcccccccc
Q psy17028        163 ------------------------------------------------------LIDAQDQEAVLNELRHSGFCDVFEYG  188 (334)
Q Consensus       163 ------------------------------------------------------f~~~~d~~~~~~~L~~~~~f~~f~~~  188 (334)
                                                                            ||++|||+++++||++++|||+|+++
T Consensus       629 WiH~MFLqfq~s~f~~~geVls~~s~~~q~L~~~W~~L~~~~~~Sf~t~miTs~FPq~KD~~~L~~EL~e~GFfdvF~~s  708 (851)
T KOG3723|consen  629 WIHIMFLQFQQSLFPEPGEVLSIQSHSVQFLRALWEKLQAGGAHSFETAMMTSTFPQQKDLDQLQLELEEVGFFDVFGFS  708 (851)
T ss_pred             HHHHHHHHHHHHhcCCccceeecchHHHHHHHHHHHHccccccccchhhHhhhcCCCcccHHHHHHHHHhcCceEEEeec
Confidence                                                                  99999999999999999999999999


Q ss_pred             ccCCCCCCcceeeeccCCcccccccCC-CCceEEEEeccccCCCcccCCceeEEEEEeCCeeEE-ec-CCCCCccceEEc
Q psy17028        189 VSGGGKEASWGCFLCNHPERAVGFLQD-SHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSY-KG-SKEDKQETPIDV  265 (334)
Q Consensus       189 ~~~~g~~~~w~c~~c~~pe~a~~~~~~-g~vlkeGwLkkK~G~~~~~K~WKrRwFVL~~~~L~Y-k~-~~~~~p~g~I~L  265 (334)
                      +++    |+|.||+|+|||||..|+.. |+++.||.||+|+|+|+++|+|++|||+|.+.+|.| +. .+++.....|||
T Consensus       709 ~T~----N~W~Cf~CnnPeKa~yFvn~~gqp~iEGQLKEKKGrWRf~kRW~TrYFTLSgA~L~~~kg~s~~dS~~~~IDl  784 (851)
T KOG3723|consen  709 ETA----NAWQCFMCNNPEKATYFVNQDGQPLIEGQLKEKKGRWRFIKRWKTRYFTLSGAQLLFQKGKSKDDSDDCPIDL  784 (851)
T ss_pred             ccc----CccceeecCChHHeeeeecCCCCchhcchhhhhccchhhhhhhccceEEecchhhhcccCCCCCCCCCCCccH
Confidence            984    59999999999999887654 589999999999999999999999999999999998 44 344445588999


Q ss_pred             CCeeEEE-ec--CCCCCCCceEEEEeCCeEEEEEcCCHHHHHHHHHHHHHHHHhhccccC
Q psy17028        266 HRIRSVK-VS--RGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEM  322 (334)
Q Consensus       266 ~~~~sV~-~~--~~~~~k~~~F~I~T~~RTy~L~AdS~ee~~eWI~AI~~aIa~~~~ke~  322 (334)
                      +++++|+ ++  +++++.|.+|+|+|.|+||.|+|+|++.++||+++|+.|++++++++.
T Consensus       785 ~~IRSVk~v~~kr~~rslpKAFEIFTAD~T~ILKaKDeKNAEEWlqCL~IavAHa~~r~~  844 (851)
T KOG3723|consen  785 SKIRSVKAVAKKRRDRSLPKAFEIFTADKTYILKAKDEKNAEEWLQCLNIAVAHAKERES  844 (851)
T ss_pred             HHhhhHHHHHhhhhhcccchhhheeecCceEEeecccccCHHHHHHHHHHHHHHHHHHHh
Confidence            9999998 54  455678899999999999999999999999999999999999777665

>cd01264 PH_melted Melted pleckstrin homology (PH) domain	Back alignment and domain information

>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01238 PH_Tec Tec pleckstrin homology (PH) domain	Back alignment and domain information

>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain	Back alignment and domain information

>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01241 PH_Akt Akt pleckstrin homology (PH) domain	Back alignment and domain information

>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain	Back alignment and domain information

>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]	Back alignment and domain information

>KOG0930\|consensus	Back alignment and domain information

>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain	Back alignment and domain information

>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain	Back alignment and domain information

>PF15409 PH_8: Pleckstrin homology domain	Back alignment and domain information

>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain	Back alignment and domain information

>smart00233 PH Pleckstrin homology domain	Back alignment and domain information

>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C	Back alignment and domain information

>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain	Back alignment and domain information

>cd00821 PH Pleckstrin homology (PH) domain	Back alignment and domain information

>cd00900 PH-like Pleckstrin homology-like domain	Back alignment and domain information

>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain	Back alignment and domain information

>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A	Back alignment and domain information

>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A	Back alignment and domain information

>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain	Back alignment and domain information

>KOG1090\|consensus	Back alignment and domain information

>KOG0690\|consensus	Back alignment and domain information

>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain	Back alignment and domain information

>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain	Back alignment and domain information

>KOG2059\|consensus	Back alignment and domain information

>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain	Back alignment and domain information

>KOG0521\|consensus	Back alignment and domain information

>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain	Back alignment and domain information

>KOG3640\|consensus	Back alignment and domain information

>PTZ00267 NIMA-related protein kinase; Provisional	Back alignment and domain information

>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain	Back alignment and domain information

>KOG0248\|consensus	Back alignment and domain information

>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain	Back alignment and domain information

>KOG3751\|consensus	Back alignment and domain information

>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis	Back alignment and domain information

>PLN02866 phospholipase D	Back alignment and domain information

>PLN00188 enhanced disease resistance protein (EDR2); Provisional	Back alignment and domain information

>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain	Back alignment and domain information

>PTZ00283 serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG0932\|consensus	Back alignment and domain information

>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain	Back alignment and domain information

>KOG1117\|consensus	Back alignment and domain information

>KOG1739\|consensus	Back alignment and domain information

>KOG3723\|consensus	Back alignment and domain information

>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain	Back alignment and domain information

>KOG0705\|consensus	Back alignment and domain information

>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain	Back alignment and domain information

>KOG4424\|consensus	Back alignment and domain information

>PF15406 PH_6: Pleckstrin homology domain	Back alignment and domain information

>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain	Back alignment and domain information

>KOG3543\|consensus	Back alignment and domain information

>KOG1451\|consensus	Back alignment and domain information

>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain	Back alignment and domain information

>PF15408 PH_7: Pleckstrin homology domain	Back alignment and domain information

>KOG1117\|consensus	Back alignment and domain information

>cd01223 PH_Vav Vav pleckstrin homology (PH) domain	Back alignment and domain information

>KOG3531\|consensus	Back alignment and domain information

>KOG4236\|consensus	Back alignment and domain information

>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain	Back alignment and domain information

>KOG0248\|consensus	Back alignment and domain information

>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain	Back alignment and domain information

>PF15404 PH_4: Pleckstrin homology domain	Back alignment and domain information

>KOG0592\|consensus	Back alignment and domain information

>KOG1737\|consensus	Back alignment and domain information

>KOG4807\|consensus	Back alignment and domain information

>KOG1738\|consensus	Back alignment and domain information

>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain	Back alignment and domain information

>KOG1170\|consensus	Back alignment and domain information

>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function	Back alignment and domain information

>PF15411 PH_10: Pleckstrin homology domain	Back alignment and domain information

>KOG1264\|consensus	Back alignment and domain information

>KOG4047\|consensus	Back alignment and domain information

>cd05134 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of the GAP1 family and has been shown to specifically bind 1,3,4,5-tetrakisphosphate (IP4)	Back alignment and domain information

>cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL	Back alignment and domain information

>cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1	Back alignment and domain information

>KOG3531\|consensus	Back alignment and domain information

>KOG3551\|consensus	Back alignment and domain information

>KOG4424\|consensus	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG3549\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		334
1fao_A		126	Dual adaptor of phosphotyrosine and 3- phosphoinos	3e-14
2dn6_A		115	KIAA0640 protein; PH domain, structural genomics,	2e-13
1eaz_A		125	Tandem PH domain containing protein-1; lipid-bindi	4e-12
2cod_A		115	Centaurin-delta 1; ARF GAP and RHO GAP with ankyri	7e-12
1x1f_A		149	Signal-transducing adaptor protein 1; docking prot	1e-11
1u5f_A		148	SRC-associated adaptor protein; PH domain of SKAP-	3e-11
2dhk_A		119	TBC1 domain family member 2; PH domain, paris-1, s	3e-11
2rsg_A		94	Collagen type IV alpha-3-binding protein; pleckstr	5e-11
3rcp_A		103	Pleckstrin homology domain-containing family A ME;	6e-11
3tfm_A		228	Myosin X; split PH domain, motor protein; 2.53A {R	1e-10
1v89_A		118	Hypothetical protein KIAA0053; pleckstrin homology	4e-10
1unq_A		125	RAC-alpha serine/threonine kinase; transferase, pl	5e-10
1u5e_A		211	SRC-associated adaptor protein; novel dimerization	5e-10
3cxb_B		112	Pleckstrin homology domain-containing family M mem	7e-10
1pls_A		113	Pleckstrin homology domain; phosphorylation; NMR {	9e-10
2da0_A		114	130-kDa phosphatidylinositol 4,5-biphosphate- depe	2e-09
1v5u_A		117	SBF1, SET binding factor 1; MTMR5, the pleckstrin	2e-09
1u5d_A		108	SKAP55, SRC kinase-associated phosphoprotein of 55	2e-09
1upq_A		123	PEPP1; PH domain, phosphoinositide binding, signal	3e-09
2dkp_A		128	Pleckstrin homology domain-containing family A mem	3e-09
1v5p_A		126	Pleckstrin homology domain-containing, family A; T	3e-09
2yry_A		122	Pleckstrin homology domain-containing family A mem	4e-09
1wgq_A		109	FYVE, rhogef and PH domain containing 6; ethanol d	6e-09
2lul_A		164	Tyrosine-protein kinase TEC; structural genomics,	8e-09
2d9y_A		117	Pleckstrin homology domain-containing protein fami	1e-08
1wi1_A		126	Calcium-dependent activator protein for secretion,	1e-08
2ys3_A		137	UNC-112-related protein 2; PH domain, kindlin-3, s	2e-08
2d9x_A		120	Oxysterol binding protein-related protein 11; PH d	4e-08
2j59_M		168	RHO-GTPase activating protein 10; ARF, ARF1, ARFBD	7e-08
4a6h_A		120	Phosphatidylinositol 4,5-bisphosphate-binding Pro	7e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-07
1x05_A		129	Pleckstrin; PH domain, structural genomics, NPPSFA	1e-07
2i5f_A		109	Pleckstrin; PH domain, protein-inositol phosphate	1e-07
1wg7_A		150	Dedicator of cytokinesis protein 9; pleckstrin hom	2e-07
1fgy_A		127	GRP1; PH domain, signaling protein; HET: 4IP; 1.50	6e-07
1x1g_A		129	Pleckstrin 2; PH domain, structural genomics, rike	1e-06
4f7h_A		173	Fermitin family homolog 2; beta-barrel, membrane b	3e-06
2dtc_A		126	RAL guanine nucleotide exchange factor ralgps1A; P	3e-06
2cof_A		107	Protein KIAA1914; PH domain, structural genomics,	4e-06
2d9v_A		130	Pleckstrin homology domain-containing protein fami	6e-06
2p0d_A		129	RHO GTPase-activating protein 9; protein-phosphoin	1e-05
1btk_A		169	Bruton'S tyrosine kinase; transferase, PH domain,	1e-05
3aj4_A		112	Pleckstrin homology domain-containing family B ME;	2e-05
2y7b_A		134	Actin-binding protein anillin; cell cycle; 1.90A {	3e-05
1v88_A		130	Oxysterol binding protein-related protein 8; vesic	3e-05
3pp2_A		124	RHO GTPase-activating protein 27; PH domain, GTPas	3e-05
3a8n_A		279	TIAM-1, T-lymphoma invasion and metastasis-inducin	5e-05
3a8p_A		263	T-lymphoma invasion and metastasis-inducing protei	6e-05
1qqg_A		264	IRS-1, insulin receptor substrate 1; beta-sandwhic	6e-05
2rlo_A		128	Centaurin-gamma 1; split PH domain, alternative sp	8e-05
3lju_X		386	ARF-GAP with dual PH domain-containing protein 1;	1e-04
2q13_A		385	DCC-interacting protein 13 alpha; APPL1, BAR domai	3e-04

>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126	Back alignment and structure

 Score = 67.8 bits (166), Expect = 3e-14
 Identities = 27/125 (21%), Positives = 50/125 (40%), Gaps = 5/125 (4%)

Query: 204 NHPERAVGFLQDSHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSY-KGSKEDKQETP 262
              E  +     S    EG L  K+G   + K W+TR+FTL    L Y K     +    
Sbjct: 4   GRTEDDLVPTAPSLGTKEGYLT-KQG--GLVKTWKTRWFTLHRNELKYFKDQMSPEPIRI 60

Query: 263 IDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQAKEM 322
           +D+    +V+    ++     F +     +  L  K G  A++W++ L   ++  + +  
Sbjct: 61  LDLTECSAVQFD-YSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLN 119

Query: 323 PTRGS 327
              G+
Sbjct: 120 QGEGT 124

PyMOL of 1fao

>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115	Back alignment and structure

>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125	Back alignment and structure

>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115	Back alignment and structure

>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149	Back alignment and structure

>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148	Back alignment and structure

>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119	Back alignment and structure

>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94	Back alignment and structure

>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103	Back alignment and structure

>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228	Back alignment and structure

>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118	Back alignment and structure

>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125	Back alignment and structure

>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211	Back alignment and structure

>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112	Back alignment and structure

>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113	Back alignment and structure

>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117	Back alignment and structure

>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108	Back alignment and structure

>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123	Back alignment and structure

>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128	Back alignment and structure

>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126	Back alignment and structure

>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122	Back alignment and structure

>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109	Back alignment and structure

>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164	Back alignment and structure

>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117	Back alignment and structure

>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126	Back alignment and structure

>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137	Back alignment and structure

>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120	Back alignment and structure

>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168	Back alignment and structure

>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129	Back alignment and structure

>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109	Back alignment and structure

>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150	Back alignment and structure

>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127	Back alignment and structure

>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129	Back alignment and structure

>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Length = 173	Back alignment and structure

>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126	Back alignment and structure

>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107	Back alignment and structure

>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130	Back alignment and structure

>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129	Back alignment and structure

>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169	Back alignment and structure

>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112	Back alignment and structure

>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134	Back alignment and structure

>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130	Back alignment and structure

>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124	Back alignment and structure

>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279	Back alignment and structure

>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263	Back alignment and structure

>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264	Back alignment and structure

>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128	Back alignment and structure

>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386	Back alignment and structure

>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		334
3tfm_A		228	Myosin X; split PH domain, motor protein; 2.53A {R	99.91
2dn6_A		115	KIAA0640 protein; PH domain, structural genomics,	99.89
1pls_A		113	Pleckstrin homology domain; phosphorylation; NMR {	99.89
1x1f_A		149	Signal-transducing adaptor protein 1; docking prot	99.89
1wi1_A		126	Calcium-dependent activator protein for secretion,	99.89
1fao_A		126	Dual adaptor of phosphotyrosine and 3- phosphoinos	99.88
2cod_A		115	Centaurin-delta 1; ARF GAP and RHO GAP with ankyri	99.88
1wgq_A		109	FYVE, rhogef and PH domain containing 6; ethanol d	99.87
1eaz_A		125	Tandem PH domain containing protein-1; lipid-bindi	99.87
1v5u_A		117	SBF1, SET binding factor 1; MTMR5, the pleckstrin	99.87
1v89_A		118	Hypothetical protein KIAA0053; pleckstrin homology	99.87
1u5d_A		108	SKAP55, SRC kinase-associated phosphoprotein of 55	99.87
1v88_A		130	Oxysterol binding protein-related protein 8; vesic	99.87
2rsg_A		94	Collagen type IV alpha-3-binding protein; pleckstr	99.86
1fgy_A		127	GRP1; PH domain, signaling protein; HET: 4IP; 1.50	99.86
1upq_A		123	PEPP1; PH domain, phosphoinositide binding, signal	99.86
2lul_A		164	Tyrosine-protein kinase TEC; structural genomics,	99.86
2dhk_A		119	TBC1 domain family member 2; PH domain, paris-1, s	99.86
1v5p_A		126	Pleckstrin homology domain-containing, family A; T	99.86
2i5f_A		109	Pleckstrin; PH domain, protein-inositol phosphate	99.86
1x05_A		129	Pleckstrin; PH domain, structural genomics, NPPSFA	99.85
2p0d_A		129	RHO GTPase-activating protein 9; protein-phosphoin	99.85
2d9v_A		130	Pleckstrin homology domain-containing protein fami	99.85
3cxb_B		112	Pleckstrin homology domain-containing family M mem	99.85
1btk_A		169	Bruton'S tyrosine kinase; transferase, PH domain,	99.85
2d9x_A		120	Oxysterol binding protein-related protein 11; PH d	99.85
2dkp_A		128	Pleckstrin homology domain-containing family A mem	99.85
2da0_A		114	130-kDa phosphatidylinositol 4,5-biphosphate- depe	99.85
2w2x_D		124	1-phosphatidylinositol-4,5-bisphosphate phosphodie	99.85
1dyn_A		125	Dynamin; signal transduction protein; 2.20A {Homo	99.85
3aj4_A		112	Pleckstrin homology domain-containing family B ME;	99.84
2yry_A		122	Pleckstrin homology domain-containing family A mem	99.84
2d9y_A		117	Pleckstrin homology domain-containing protein fami	99.84
1wg7_A		150	Dedicator of cytokinesis protein 9; pleckstrin hom	99.84
3rcp_A		103	Pleckstrin homology domain-containing family A ME;	99.84
1unq_A		125	RAC-alpha serine/threonine kinase; transferase, pl	99.84
1u5f_A		148	SRC-associated adaptor protein; PH domain of SKAP-	99.84
2rlo_A		128	Centaurin-gamma 1; split PH domain, alternative sp	99.83
4a6h_A		120	Phosphatidylinositol 4,5-bisphosphate-binding Pro	99.83
1x1g_A		129	Pleckstrin 2; PH domain, structural genomics, rike	99.82
2y7b_A		134	Actin-binding protein anillin; cell cycle; 1.90A {	99.82
1wjm_A		123	Beta-spectrin III; PH domain, signal transduction,	99.82
2coc_A		112	FYVE, rhogef and PH domain containing protein 3; s	99.82
2j59_M		168	RHO-GTPase activating protein 10; ARF, ARF1, ARFBD	99.81
1btn_A		106	Beta-spectrin; signal transduction protein; HET: I	99.81
2cof_A		107	Protein KIAA1914; PH domain, structural genomics,	99.8
1u5e_A		211	SRC-associated adaptor protein; novel dimerization	99.8
3lju_X		386	ARF-GAP with dual PH domain-containing protein 1;	99.79
3pp2_A		124	RHO GTPase-activating protein 27; PH domain, GTPas	99.79
1dro_A		122	Beta-spectrin; cytoskeleton; NMR {Drosophila melan	99.79
3a8p_A		263	T-lymphoma invasion and metastasis-inducing protei	99.77
1qqg_A		264	IRS-1, insulin receptor substrate 1; beta-sandwhic	99.77
2q13_A		385	DCC-interacting protein 13 alpha; APPL1, BAR domai	99.76
2r09_A		347	Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph	99.74
2dtc_A		126	RAL guanine nucleotide exchange factor ralgps1A; P	99.74
4h8s_A		407	DCC-interacting protein 13-beta; BAR domain, pleck	99.73
2rov_A		117	RHO-associated protein kinase 2; ATP-binding, coil	99.72
3tca_A		291	Amyloid beta A4 precursor protein-binding family 1	99.67
3lju_X		386	ARF-GAP with dual PH domain-containing protein 1;	99.65
2fjl_A		150	1-phosphatidylinositol-4,5-bisphosphate phosphodie	99.64
2ys3_A		137	UNC-112-related protein 2; PH domain, kindlin-3, s	99.59
2d9w_A		127	Docking protein 2; PH domain, structural genomics,	99.59
4ejn_A		446	RAC-alpha serine/threonine-protein kinase; AKT1, a	99.57
3a8n_A		279	TIAM-1, T-lymphoma invasion and metastasis-inducin	99.52
1w1g_A		151	HPDK1, 3-phosphoinositide dependent protein kinase	99.51
2coa_A		125	Protein kinase C, D2 type; protein kinase D2, PH d	99.44
3hk0_A		256	Growth factor receptor-bound protein 10; GRB10, RA	99.41
2d9z_A		129	Protein kinase C, NU type; PH domain, structural g	99.37
4gmv_A		281	RAS-associated and pleckstrin homology domains-CO	99.3
4f7h_A		173	Fermitin family homolog 2; beta-barrel, membrane b	99.13
4bbk_A		165	Kindlin-1, fermitin family homolog 1; PH domain, c	99.08
1v5m_A		136	SH2 and PH domain-containing adapter protein APS;	98.6
3ml4_A		224	Protein DOK-7; tyrosine phosphorylation, adapter p	98.55
1zc3_B		113	Exocyst complex protein EXO84; exocytosis, small G	98.36
1v61_A		132	RAC/CDC42 guanine nucleotide exchange factor (GEF)	98.27
1mai_A		131	Phospholipase C delta-1; pleckstrin, inositol tris	98.26
3mpx_A		434	FYVE, rhogef and PH domain-containing protein 5; s	98.13
2vrw_B		406	P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP	98.05
3ky9_A		587	Proto-oncogene VAV; calponin homology domain, DBL	97.98
3t06_A		418	PDZ-rhogef, RHO guanine nucleotide exchange factor	97.9
3tfm_A		228	Myosin X; split PH domain, motor protein; 2.53A {R	97.88
2lg1_A		185	A-kinase anchor protein 13; metal binding protein;	97.86
1dbh_A		354	Protein (human SOS 1); guanine nucleotide exchange	97.85
2pz1_A		466	RHO guanine nucleotide exchange factor 4; helical	97.84
1xcg_A		368	PDZ-rhogef, RHO guanine nucleotide exchange factor	97.81
2dfk_A		402	Collybistin II; DH domain, PH domain, cell cycle;	97.77
1nty_A		311	Triple functional domain protein; DBL, pleckstrin,	97.71
3qwm_A		140	Iqsec1, IQ motif and SEC7 domain-containing protei	97.59
3jzy_A		510	Intersectin 2; C2 domain, structural genomics cons	97.58
3p6a_A		377	RHO guanine nucleotide exchange factor 1; regulati	97.56
1txd_A		385	RHO guanine nucleotide exchange factor 12; helical	97.54
1kz7_A		353	Guanine nucleotide exchange factor DBS; guanine nu	97.54
2z0q_A		346	XPLN, RHO guanine nucleotide exchange factor 3; DH	97.53
3v5w_A		689	G-protein coupled receptor kinase 2; inhibitor com	97.5
3odw_A		536	RHO guanine nucleotide exchange factor 1; regulati	97.48
1foe_A		377	T-lymphoma invasion and metastasis inducing protei	97.43
2rgn_B		354	RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p	97.33
3ksy_A		1049	SOS-1, SON of sevenless homolog 1; RAS, RAS activa	96.57
1z87_A		263	Alpha-1-syntrophin; protein binding; NMR {Mus musc	95.99
3zvr_A		772	Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito	95.96
2adz_A		178	Alpha-1-syntrophin; protein binding; NMR {Mus musc	95.65
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	93.96
3tjz_B		355	Coatomer subunit gamma; protein trafficking, golgi	93.53
1fho_A		119	UNC-89; pleckstrin homology domain, electrostatics	93.09
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	92.8
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	92.24
3ulb_A		121	Target of rapamycin complex 2 subunit AVO1; PH dom	91.11
3a98_B		203	Engulfment and cell motility protein 1; protein-pr	90.24
2vgl_A		621	Adaptor protein complex AP-2, alpha 2 subunit; cyt	89.61
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	89.1
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	84.52
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	82.34
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	81.47
3hie_A		171	Protein PSL1, exocyst complex component SEC3; PH d	80.98

>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus}	Back alignment and structure

Probab=99.91  E-value=3.6e-24  Score=196.16  Aligned_cols=135  Identities=21%  Similarity=0.414  Sum_probs=113.0

Q ss_pred             hhcCccccccccccCCCCCCcceeeeccCCcccccccCCC-CceEEEEeccccCCCc--ccCCceeEEEEEeCCeeE-Ee
Q psy17028        177 RHSGFCDVFEYGVSGGGKEASWGCFLCNHPERAVGFLQDS-HPVIEGQLKEKKGRWK--IFKRWRTRYFTLSGAHLS-YK  252 (334)
Q Consensus       177 ~~~~~f~~f~~~~~~~g~~~~w~c~~c~~pe~a~~~~~~g-~vlkeGwLkkK~G~~~--~~K~WKrRwFVL~~~~L~-Yk  252 (334)
                      .-.+||+.|.+++  ||.++.|..+||.+.+.+..+++.. .++++|||.|+++..+  ..++||+|||||+++.|. |+
T Consensus        18 ~~~~~~~g~l~~~--~~~~~~w~~rw~vl~~~~~~~~~~~~~~~k~G~L~K~g~~~~~~~~k~WkkRwfvL~~~~L~Yyk   95 (228)
T 3tfm_A           18 PGSPYFHSFLYMN--GGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHNNGGGSSTLSRRNWKKRWFVLRQSKLMYFE   95 (228)
T ss_dssp             ---CCEEEEEEEC--CTTTCCCEEEEEEEETTEEEEESSCCCSSEEEEEEECGGGCSSSCGGGCEEEEEEECSSEEEEES
T ss_pred             CCCCceEEEEeec--CcccccceEEEEEEeCCEEEEeccCCCcceEEEEEEECCCcCCcccCCceEEEEEEeCCEEEEEe
Confidence            4568999999999  8999999999999999999888876 7999999954443211  128999999999999998 45


Q ss_pred             cCCCCCccceEEcCCeeEEEecCCCCCCCceEEEEeCCeEEEEEcCCHHHHHHHHHHHHHHHHh
Q psy17028        253 GSKEDKQETPIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAH  316 (334)
Q Consensus       253 ~~~~~~p~g~I~L~~~~sV~~~~~~~~k~~~F~I~T~~RTy~L~AdS~ee~~eWI~AI~~aIa~  316 (334)
                      ++.+..+.|.|+|..++.|....   .++++|+|.|++|+|+|+|+|++|+++||++|+.++..
T Consensus        96 ~~~~~~~~g~I~L~~~~~v~~~~---~k~~~F~I~t~~r~~~l~A~s~~e~~~Wv~aL~~~i~~  156 (228)
T 3tfm_A           96 NDSEEKLKGTVEVRSAKEIIDNT---NKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHSS  156 (228)
T ss_dssp             STTCCSEEEEEEGGGCSEEEEET---TTTSEEEEECSSCEEEEECSSHHHHHHHHHHHHHHHTC
T ss_pred             CCCCcceeEEEEcCCCEEeccCC---CCCcEEEEEcCCcEEEEEcCCHHHHHHHHHHHHHHHhc
Confidence            55666899999999988765422   45789999999999999999999999999999999973

PyMOL of 3tfm

>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A	Back alignment and structure

>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens}	Back alignment and structure

>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A*	Back alignment and structure

>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A*	Back alignment and structure

>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens}	Back alignment and structure

>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A	Back alignment and structure

>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A	Back alignment and structure

>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A*	Back alignment and structure

>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B	Back alignment and structure

>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A*	Back alignment and structure

>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens}	Back alignment and structure

>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A	Back alignment and structure

>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A	Back alignment and structure

>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A	Back alignment and structure

>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A	Back alignment and structure

>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A	Back alignment and structure

>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A	Back alignment and structure

>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens}	Back alignment and structure

>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A	Back alignment and structure

>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens}	Back alignment and structure

>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A	Back alignment and structure

>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A	Back alignment and structure

>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A	Back alignment and structure

>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C*	Back alignment and structure

>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens}	Back alignment and structure

>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1	Back alignment and structure

>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A	Back alignment and structure

>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A*	Back alignment and structure

>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A	Back alignment and structure

>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A*	Back alignment and structure

>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus}	Back alignment and structure

>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens}	Back alignment and structure

>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus}	Back alignment and structure

>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus}	Back alignment and structure

>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C*	Back alignment and structure

>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1	Back alignment and structure

>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A*	Back alignment and structure

>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus}	Back alignment and structure

>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A	Back alignment and structure

>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens}	Back alignment and structure

>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A	Back alignment and structure

>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A*	Back alignment and structure

>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus}	Back alignment and structure

>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus}	Back alignment and structure

>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B*	Back alignment and structure

>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1	Back alignment and structure

>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens}	Back alignment and structure

>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A	Back alignment and structure

>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A	Back alignment and structure

>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens}	Back alignment and structure

>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus}	Back alignment and structure

>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A	Back alignment and structure

>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D	Back alignment and structure

>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A*	Back alignment and structure

>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1	Back alignment and structure

>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A	Back alignment and structure

>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens}	Back alignment and structure

>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B	Back alignment and structure

>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A	Back alignment and structure

>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A	Back alignment and structure

>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A	Back alignment and structure

>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A	Back alignment and structure

>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A	Back alignment and structure

>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A	Back alignment and structure

>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1	Back alignment and structure

>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens}	Back alignment and structure

>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A	Back alignment and structure

>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus}	Back alignment and structure

>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A	Back alignment and structure

>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus}	Back alignment and structure

>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>3ulb_A Target of rapamycin complex 2 subunit AVO1; PH domain, membrane localization, membrane protein; 1.90A {Saccharomyces cerevisiae} PDB: 3ulc_A	Back alignment and structure

>3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A	Back alignment and structure

>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>3hie_A Protein PSL1, exocyst complex component SEC3; PH domain, dimer, domain swapping, phosphate-binding, coiled coil, exocytosis; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		334
d1eaza_		103	b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId:	3e-08
d1u5ea1		209	b.55.1.1 (A:14-222) Src-associated adaptor protein	4e-08
d1faoa_		100	b.55.1.1 (A:) Dual adaptor of phosphotyrosine and	1e-07
d1plsa_		113	b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta	2e-07
d1v89a_		118	b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI	7e-07
d1u5da1		106	b.55.1.1 (A:108-213) Src kinase-associated phospho	2e-06
d1fgya_		127	b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1	3e-06
d1omwa2		119	b.55.1.1 (A:550-668) G-protein coupled receptor ki	5e-06
d2elba2		101	b.55.1.1 (A:274-374) DCC-interacting protein 13-al	5e-06
d1v5ua_		117	b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M	5e-06
d1v88a_		130	b.55.1.1 (A:) Oxysterol binding protein-related pr	8e-06
d2coda1		102	b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo	1e-05
d1wjma_		123	b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens),	1e-05
d1u5fa1		111	b.55.1.1 (A:109-219) Src-associated adaptor protei	2e-05
d1unqa_		118	b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H	2e-05
d1btka_		169	b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom	3e-05
d1droa_		122	b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila	4e-05
d2j59m1		133	b.55.1.1 (M:931-1063) Rho GTPase-activating protei	7e-05
d1upqa_		107	b.55.1.1 (A:) Phosphoinositol 3-phosphate binding	1e-04
d2i5fa1		104	b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie	1e-04
d1wi1a_		126	b.55.1.1 (A:) Calcium-dependent activator protein	2e-04
d1w1ha_		147	b.55.1.1 (A:) 3-phosphoinositide dependent protein	2e-04
d1btna_		106	b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus),	2e-04
d1x1fa1		136	b.55.1.1 (A:8-143) Signal-transducing adaptor prot	2e-04
d1v5pa_		126	b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId:	4e-04
d1wgqa_		109	b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin	4e-04
d1x1ga1		116	b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie	7e-04
d2cofa1		95	b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens)	0.001
d1wg7a_		150	b.55.1.1 (A:) Dedicator of cytokinesis protein 9,	0.003
d2coca1		99	b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont	0.004

>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure


class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Tapp1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 48.6 bits (115), Expect = 3e-08
 Identities = 21/106 (19%), Positives = 44/106 (41%), Gaps = 6/106 (5%)

Query: 216 SHPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLSY-KGSKEDKQETPIDVHRIRSVKVS 274
           S  +  G    K+G   + K W+ RYF L    + Y K   E +    I +  +  V+  
Sbjct: 1   SAVIKAGYC-VKQG--AVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQEC 57

Query: 275 RGARNIPK--AFEIFTGDDSLILKPKNGKNAEQWVQCLSVVVAHSQ 318
           + +  + +   FEI T   +  ++  + +    W++ +S  +   +
Sbjct: 58  KQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQR 103

PyMOL of d1eaza_

>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209	Back information, alignment and structure

>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100	Back information, alignment and structure

>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113	Back information, alignment and structure

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118	Back information, alignment and structure

>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106	Back information, alignment and structure

>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127	Back information, alignment and structure

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119	Back information, alignment and structure

>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117	Back information, alignment and structure

>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130	Back information, alignment and structure

>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure

>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123	Back information, alignment and structure

>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111	Back information, alignment and structure

>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118	Back information, alignment and structure

>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169	Back information, alignment and structure

>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122	Back information, alignment and structure

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133	Back information, alignment and structure

>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107	Back information, alignment and structure

>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104	Back information, alignment and structure

>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126	Back information, alignment and structure

>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147	Back information, alignment and structure

>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106	Back information, alignment and structure

>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136	Back information, alignment and structure

>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126	Back information, alignment and structure

>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109	Back information, alignment and structure

>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116	Back information, alignment and structure

>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95	Back information, alignment and structure

>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150	Back information, alignment and structure

>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		334
d1faoa_		100	Dual adaptor of phosphotyrosine and 3-phosphoinosi	99.89
d2coaa1		112	Protein kinase c, d2 type {Human (Homo sapiens) [T	99.88
d2coda1		102	Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96	99.86
d1plsa_		113	Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	99.84
d1v89a_		118	Rho-GTPase-activating protein 25 (KIAA0053) {Human	99.84
d1eaza_		103	Tapp1 {Human (Homo sapiens) [TaxId: 9606]}	99.84
d2fjla1		101	Phosphoinositide phospholipase C, PLC-gamma-1 {Rat	99.84
d1v88a_		130	Oxysterol binding protein-related protein 8 (ORP-8	99.84
d1wi1a_		126	Calcium-dependent activator protein for secretion,	99.83
d1x1fa1		136	Signal-transducing adaptor protein 1, STAP-1 {Huma	99.83
d2dyna_		111	Dynamin {Human (Homo sapiens) [TaxId: 9606]}	99.83
d1wgqa_		109	FYVE, RhoGEF and PH domain containing protein 6, F	99.82
d1btka_		169	Bruton's tyrosine kinase {Human (Homo sapiens) [Ta	99.82
d1w1ha_		147	3-phosphoinositide dependent protein kinase-1 {Hum	99.82
d1u5da1		106	Src kinase-associated phosphoprotein SKAP55 (SCAP1	99.82
d1v5ua_		117	SET binding factor 1, Sbf1 {Mouse (Mus musculus) [	99.82
d1fgya_		127	Grp1 {Mouse (Mus musculus) [TaxId: 10090]}	99.81
d1upqa_		107	Phosphoinositol 3-phosphate binding protein-1, PEP	99.81
d2coca1		99	FYVE, RhoGEF and PH domain containing protein 3, F	99.81
d1omwa2		119	G-protein coupled receptor kinase 2 (beta-adrenerg	99.81
d1u5fa1		111	Src-associated adaptor protein Skap2 {Mouse (Mus m	99.8
d1qqga1		103	Insulin receptor substrate 1, IRS-1 {Human (Homo s	99.8
d2j59m1		133	Rho GTPase-activating protein 21 {Human (Homo sapi	99.8
d1wg7a_		150	Dedicator of cytokinesis protein 9, DOCK9 {Human (	99.8
d2i5fa1		104	Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	99.79
d1unqa_		118	Rac-alpha serine/threonine kinase {Human (Homo sap	99.78
d1u5ea1		209	Src-associated adaptor protein Skap2 {Mouse (Mus m	99.78
d1x1ga1		116	Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}	99.77
d2elba2		101	DCC-interacting protein 13-alpha, APPL1 {Human (Ho	99.76
d1v5ma_		136	SH2 and PH domain-containing adapter protein APS {	99.75
d1v5pa_		126	Tapp2 {Mouse (Mus musculus) [TaxId: 10090]}	99.75
d1btna_		106	beta-spectrin {Mouse (Mus musculus), brain [TaxId:	99.72
d1wjma_		123	beta-spectrin {Human (Homo sapiens), brain 2 isofo	99.7
d2cofa1		95	KIAA1914 {Human (Homo sapiens) [TaxId: 9606]}	99.7
d1droa_		122	beta-spectrin {Fruit fly (Drosophila melanogaster)	99.66
d1v61a_		132	Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [	99.26
d1maia_		119	Phospholipase C delta-1 {Rat (Rattus norvegicus) [	99.04
d2dfka2		162	Rho guanine nucleotide exchange factor 9, Collybis	98.86
d1zc3b1		109	Exocyst complex protein EXO84 {Rat (Rattus norvegi	98.85
d1ki1b2		142	GEF of intersectin {Human (Homo sapiens) [TaxId: 9	98.64
d1dbha2		133	Son of sevenless-1 (sos-1) {Human (Homo sapiens) [	98.63
d1ntya2		121	Triple functional domain protein TRIO {Human (Homo	98.3
d1xcga2		140	Rho guanine nucleotide exchange factor 11, PDZ-Rho	98.28
d1txda2		114	Rho guanine nucleotide exchange factor 12 {Human (	97.95
d1kz7a2		147	Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId	97.84
d1fhoa_		119	UNC-89 {Nematode (Caenorhabditis elegans) [TaxId:	97.78
d2adza1		105	Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1	97.56
d2zkmx3		131	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	96.57
d1foea2		162	GEF of TIAM1 (T-Lymphoma invasion and metastasis i	88.16

>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=4.1e-23  Score=162.72  Aligned_cols=96  Identities=23%  Similarity=0.409  Sum_probs=81.9

Q ss_pred             CceEEEEeccccCCCcccCCceeEEEEEeCCeeE-EecCCCCCccceEEcCCeeEEEecCCCCCCCceEEEEeCCeEEEE
Q psy17028        217 HPVIEGQLKEKKGRWKIFKRWRTRYFTLSGAHLS-YKGSKEDKQETPIDVHRIRSVKVSRGARNIPKAFEIFTGDDSLIL  295 (334)
Q Consensus       217 ~vlkeGwLkkK~G~~~~~K~WKrRwFVL~~~~L~-Yk~~~~~~p~g~I~L~~~~sV~~~~~~~~k~~~F~I~T~~RTy~L  295 (334)
                      .+.|||||.| +|+.  .|+|++|||||+++.|. |+++.+..|.|.|+|..+..|..... .+++++|+|.|++|+|+|
T Consensus         3 ~~~KeG~L~K-~~~~--~k~Wk~R~fvL~~~~L~yy~~~~~~~~~g~i~L~~~~~v~~~~~-~~~~~~F~i~~~~r~~~l   78 (100)
T d1faoa_           3 LGTKEGYLTK-QGGL--VKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYS-QERVNCFCLVFPFRTFYL   78 (100)
T ss_dssp             TTCEEEEEEE-ECSS--SCCEEEEEEEEETTEEEEESSTTCSSCSEEEEGGGCCEEEEECS-SSSSSEEEEEETTEEEEE
T ss_pred             CccEEEEEEE-eCCC--CCCceEEEEEEECCEEEEEeccCCccCceEEechheEEEEeccc-cccccccccccCCeEEEE
Confidence            4579999955 4544  69999999999999998 55666778999999999887765433 356789999999999999


Q ss_pred             EcCCHHHHHHHHHHHHHHHHh
Q psy17028        296 KPKNGKNAEQWVQCLSVVVAH  316 (334)
Q Consensus       296 ~AdS~ee~~eWI~AI~~aIa~  316 (334)
                      +|+|++++++||++|+.+|.+
T Consensus        79 ~a~s~~~~~~Wi~ai~~~i~~   99 (100)
T d1faoa_          79 CAKTGVEADEWIKILRWKLSQ   99 (100)
T ss_dssp             ECSSHHHHHHHHHHHHHHHHT
T ss_pred             EeCCHHHHHHHHHHHHHHHhh
Confidence            999999999999999999865

PyMOL of d1faoa_

>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]}	Back information, alignment and structure

>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]}	Back information, alignment and structure

>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}	Back information, alignment and structure

>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure