Diaphorina citri psyllid: psy17033


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MEPAFDNSTRQIIIDSLKELGFKFHDKGTAVCIEGPRFSSRAESNLFRSWNAHLVNMTLVPEVVLAKEAGLLYAAVAMATDYDCWRDTGNKVCVADVLKTFKENVEKITKLFVHIVPKIAAKDWTNEITELKSVVETSNMSPQSPQKS
ccccccHHHHHHHHHHHHHHccCECcccEEEEEcccccccHHHHHHHHHccccEEcccccHHHHHHHHccccccEEHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccc
**PAFDNSTRQIIIDSLKELGFKFHDKGTAVCIEGPRFSSRAESNLFRSWNAHLVNMTLVPEVVLAKEAGLLYAAVAMATDYDCWRDTGNKVCVADVLKTFKENVEKITKLFVHIVPKIAAKDWTNEITELKSVVET***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPAFDNSTRQIIIDSLKELGFKFHDKGTAVCIEGPRFSSRAESNLFRSWNAHLVNMTLVPEVVLAKEAGLLYAAVAMATDYDCWRDTGNKVCVADVLKTFKENVEKITKLFVHIVPKIAAKDWTNEITELKSVVETSNMSPQSPQKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
S-methyl-5'-thioadenosine phosphorylase Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.confidentF6V515
S-methyl-5'-thioadenosine phosphorylase Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.confidentQ9V813
S-methyl-5'-thioadenosine phosphorylase Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.confidentQ291H4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006738 [BP]nicotinamide riboside catabolic processprobableGO:0044248, GO:0034641, GO:0006807, GO:0044281, GO:0046495, GO:0072524, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0071704, GO:0072526, GO:0046483, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0008150, GO:0009116, GO:0008152, GO:0034655, GO:0009056, GO:0055086, GO:1901565, GO:0044238, GO:1901564, GO:0044270, GO:0070638, GO:0070637, GO:1901135, GO:0009164, GO:0044237, GO:1901657, GO:1901136, GO:0019439, GO:1901658
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0017061 [MF]S-methyl-5-thioadenosine phosphorylase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016763

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CB0, chain A
Confidence level:very confident
Coverage over the Query: 1-142
View the alignment between query and template
View the model in PyMOL