Diaphorina citri psyllid: psy17035


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MAFVLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR
cEEEEEccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MAFVLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFVLCWSPYIVFDLLQVYGYIPRTQNYIAVATLIQSLAPLNSAANPIIYCIFRTGNNNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cardioacceleratory peptide receptor Binds to the cardioacceleratory peptide, which is a neuropeptide.confidentQ868T3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001653 [MF]peptide receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0018990 [BP]ecdysis, chitin-based cuticleprobableGO:0032501, GO:0044707, GO:0007591, GO:0022404, GO:0008150, GO:0042303, GO:0044699
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0004930 [MF]G-protein coupled receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KS9, chain A
Confidence level:very confident
Coverage over the Query: 2-60
View the alignment between query and template
View the model in PyMOL