Diaphorina citri psyllid: psy1704

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MFEVFSEFGVHSAAQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTK
ccEEEECcccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccccEEEEccccccccccccccCEEECccccccccccccc
*FEVFSEFGVHSAAQSCPAN*KVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPN**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEVFSEFGVHSAAQSCPANPKVMGSNHKVAILGAGIIGLSTALELQRRFPNCDVTVIADKFNMDTTSDGAAGLFEPSPNFMGPDLETTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
D-amino-acid oxidase 2 Could act as a detoxifying agent which removes D-amino acids accumulated during aging (By similarity). Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.confidentQ95XG9
D-aspartate oxidase Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.confidentQ922Z0
D-aspartate oxidase Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.confidentQ99489

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048037 [MF]cofactor bindingprobableGO:0003674, GO:0005488
GO:0019478 [BP]D-amino acid catabolic processprobableGO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:1901605, GO:1901606, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237, GO:0046416
GO:0006533 [BP]aspartate catabolic processprobableGO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0009068, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:1901605, GO:1901606, GO:0044238, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0043649, GO:0043648, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237, GO:0006531, GO:0009066
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0047821 [MF]D-glutamate oxidase activityprobableGO:0003824, GO:0016641, GO:0003674, GO:0016638, GO:0016491
GO:0008445 [MF]D-aspartate oxidase activityprobableGO:0015922, GO:0016638, GO:0016641, GO:0003824, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G3E, chain A
Confidence level:very confident
Coverage over the Query: 29-78
View the alignment between query and template
View the model in PyMOL