Diaphorina citri psyllid: psy17087


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MNHPNDHKGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAYEV
ccccccccccccccccEEEccccccccccccccEEEEEEcccccEEEEEEEECccccccccccCEEEEccccHHHHHHHHHccc
*******KGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHPNDHKGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAYEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0009566 [BP]fertilizationprobableGO:0044702, GO:0000003, GO:0019953, GO:0022414, GO:0008150, GO:0044699
GO:0045744 [BP]negative regulation of G-protein coupled receptor protein signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0008277, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0045745 [BP]positive regulation of G-protein coupled receptor protein signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0008277, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048730 [BP]epidermis morphogenesisprobableGO:0032502, GO:0009887, GO:0008544, GO:0044707, GO:0032501, GO:0048856, GO:0009888, GO:0044767, GO:0048513, GO:0008150, GO:0048729, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0070684 [BP]seminal clot liquefactionprobableGO:0044703, GO:0044702, GO:0048609, GO:0032504, GO:0044706, GO:0007618, GO:0007620, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0051704, GO:0007320, GO:0000003
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0031638 [BP]zymogen activationprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152, GO:0016485
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TVJ, chain B
Confidence level:very confident
Coverage over the Query: 11-82
View the alignment between query and template
View the model in PyMOL