Psyllid ID: psy17087


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MNHPNDHKGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAYEV
ccccccccccccccccEEEccccccccccccccEEEEEEcccccEEEEEEEEEccccccccccEEEEEccccHHHHHHHHHccc
ccccccccccEEccHHHEccccccEccccccccEEEEEEccEcEEEEEEEEEccccccccccccEEEHHHHHHHHHHHHHcccc
mnhpndhkgdisvtETKFLvfpgkdscngdsggplvwknndtrkhYLIGLvsygtpecgigspgiyTRITAYLPWIIARMAYEV
mnhpndhkgdisvTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAYEV
MNHPNDHKGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAYEV
*************TETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAY**
*******KGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMA***
*********DISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAYEV
*****DHKGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHPNDHKGDISVTETKFLVFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAYEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q5U405543 Transmembrane protease se yes N/A 0.714 0.110 0.5 2e-10
Q5E9Z2558 Hyaluronan-binding protei no N/A 0.892 0.134 0.455 6e-10
Q9BYE2581 Transmembrane protease se yes N/A 0.666 0.096 0.5 6e-10
O60235418 Transmembrane protease se no N/A 0.619 0.124 0.527 1e-09
Q9JJS8685 Mannan-binding lectin ser no N/A 0.630 0.077 0.535 1e-09
Q14520560 Hyaluronan-binding protei no N/A 0.880 0.132 0.448 2e-09
Q91WP0685 Mannan-binding lectin ser no N/A 0.642 0.078 0.490 2e-09
Q8K0D2558 Hyaluronan-binding protei no N/A 0.892 0.134 0.443 3e-09
Q6L711558 Hyaluronan-binding protei no N/A 0.892 0.134 0.443 3e-09
Q8VCA5435 Transmembrane protease se no N/A 0.607 0.117 0.5 3e-09
>sp|Q5U405|TMPSD_MOUSE Transmembrane protease serine 13 OS=Mus musculus GN=Tmprss13 PE=2 SV=2 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%)

Query: 23  GKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIARMAY 82
           G+DSC GDSGGPLV + N+  + YL G+ S+GT       PG+YT++T  LPWI  +M  
Sbjct: 479 GRDSCQGDSGGPLVCEQNN--RWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWIYRKMES 536

Query: 83  EV 84
           EV
Sbjct: 537 EV 538





Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q5E9Z2|HABP2_BOVIN Hyaluronan-binding protein 2 OS=Bos taurus GN=HABP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9BYE2|TMPSD_HUMAN Transmembrane protease serine 13 OS=Homo sapiens GN=TMPRSS13 PE=2 SV=3 Back     alignment and function description
>sp|O60235|TM11D_HUMAN Transmembrane protease serine 11D OS=Homo sapiens GN=TMPRSS11D PE=1 SV=1 Back     alignment and function description
>sp|Q9JJS8|MASP2_RAT Mannan-binding lectin serine protease 2 OS=Rattus norvegicus GN=Masp2 PE=1 SV=2 Back     alignment and function description
>sp|Q14520|HABP2_HUMAN Hyaluronan-binding protein 2 OS=Homo sapiens GN=HABP2 PE=1 SV=1 Back     alignment and function description
>sp|Q91WP0|MASP2_MOUSE Mannan-binding lectin serine protease 2 OS=Mus musculus GN=Masp2 PE=1 SV=1 Back     alignment and function description
>sp|Q8K0D2|HABP2_MOUSE Hyaluronan-binding protein 2 OS=Mus musculus GN=Habp2 PE=1 SV=2 Back     alignment and function description
>sp|Q6L711|HABP2_RAT Hyaluronan-binding protein 2 OS=Rattus norvegicus GN=Habp2 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCA5|TMPS4_MOUSE Transmembrane protease serine 4 OS=Mus musculus GN=Tmprss4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
225713904 483 Serine protease easter precursor [Lepeop 0.702 0.122 0.508 3e-12
195111956 283 GI22460 [Drosophila mojavensis] gi|19391 0.809 0.240 0.441 7e-12
225709020 485 Serine protease easter precursor [Caligu 0.857 0.148 0.493 2e-11
170055456 367 urokinase-type plasminogen activator [Cu 0.690 0.158 0.5 3e-11
328721534 432 PREDICTED: transmembrane protease serine 0.666 0.129 0.576 3e-11
158300254 324 AGAP012328-PA [Anopheles gambiae str. PE 0.928 0.240 0.439 4e-11
195588110 319 GD13921 [Drosophila simulans] gi|1941958 0.654 0.172 0.548 4e-11
239792265128 ACYPI007244 [Acyrthosiphon pisum] 0.666 0.437 0.576 5e-11
24658948 319 CG6462 [Drosophila melanogaster] gi|7295 0.654 0.172 0.548 5e-11
73913562 455 hemolymph proteinase 12 [Manduca sexta] 0.666 0.123 0.610 6e-11
>gi|225713904|gb|ACO12798.1| Serine protease easter precursor [Lepeophtheirus salmonis] Back     alignment and taxonomy information
 Score = 75.9 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 2/61 (3%)

Query: 22  PGKDSCNGDSGGPLVWKNNDTRK--HYLIGLVSYGTPECGIGSPGIYTRITAYLPWIIAR 79
           P KDSCN DSGGPL++K N+  +   + +G+VS+GT  CG+G PGIYTR++++L WI  +
Sbjct: 421 PQKDSCNADSGGPLIYKANEFSETPMFQVGIVSFGTRTCGVGKPGIYTRVSSFLDWIDQK 480

Query: 80  M 80
           +
Sbjct: 481 L 481




Source: Lepeophtheirus salmonis

Species: Lepeophtheirus salmonis

Genus: Lepeophtheirus

Family: Caligidae

Order: Siphonostomatoida

Class: Maxillopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195111956|ref|XP_002000542.1| GI22460 [Drosophila mojavensis] gi|193917136|gb|EDW16003.1| GI22460 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|225709020|gb|ACO10356.1| Serine protease easter precursor [Caligus rogercresseyi] Back     alignment and taxonomy information
>gi|170055456|ref|XP_001863590.1| urokinase-type plasminogen activator [Culex quinquefasciatus] gi|167875413|gb|EDS38796.1| urokinase-type plasminogen activator [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328721534|ref|XP_001944315.2| PREDICTED: transmembrane protease serine 9-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158300254|ref|XP_320219.3| AGAP012328-PA [Anopheles gambiae str. PEST] gi|157013070|gb|EAA00349.3| AGAP012328-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195588110|ref|XP_002083801.1| GD13921 [Drosophila simulans] gi|194195810|gb|EDX09386.1| GD13921 [Drosophila simulans] Back     alignment and taxonomy information
>gi|239792265|dbj|BAH72494.1| ACYPI007244 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|24658948|ref|NP_648011.1| CG6462 [Drosophila melanogaster] gi|7295398|gb|AAF50715.1| CG6462 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|73913562|gb|AAZ91694.1| hemolymph proteinase 12 [Manduca sexta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
FB|FBgn0035663319 CG6462 [Drosophila melanogaste 0.595 0.156 0.578 2.9e-14
ZFIN|ZDB-GENE-090309-3506 tmprss13a "transmembrane prote 0.702 0.116 0.516 4.6e-12
FB|FBgn0051219345 CG31219 [Drosophila melanogast 0.678 0.165 0.542 8.8e-12
FB|FBgn0027930399 MP1 "Melanization Protease 1" 0.642 0.135 0.543 1.3e-11
UNIPROTKB|E9PIJ5532 TMPRSS13 "Transmembrane protea 0.702 0.110 0.523 1.7e-11
UNIPROTKB|F1S5J5552 HABP2 "Uncharacterized protein 0.880 0.134 0.461 1.9e-11
UNIPROTKB|E9PRA0567 TMPRSS13 "Transmembrane protea 0.702 0.104 0.523 1.9e-11
RGD|1310872525 Tmprss13 "transmembrane protea 0.702 0.112 0.523 2.8e-11
FB|FBgn0036738270 CG7542 [Drosophila melanogaste 0.630 0.196 0.517 2.9e-11
MGI|MGI:2682935543 Tmprss13 "transmembrane protea 0.702 0.108 0.523 3e-11
FB|FBgn0035663 CG6462 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 2.9e-14, Sum P(2) = 2.9e-14
 Identities = 33/57 (57%), Positives = 42/57 (73%)

Query:    23 GKDSCNGDSGGPLV--WKNNDTRKHYLIGLVSYGTPE-CGIGSPGIYTRITAYLPWI 76
             G+ +CNGDSGGP+V  W+N      YLIG+ S+G+ E C +G P +YTRITAYLPWI
Sbjct:   259 GRGACNGDSGGPVVYHWRNVS----YLIGVTSFGSAEGCEVGGPTVYTRITAYLPWI 311


GO:0004252 "serine-type endopeptidase activity" evidence=IEA;NAS
GO:0006508 "proteolysis" evidence=IEA;NAS
ZFIN|ZDB-GENE-090309-3 tmprss13a "transmembrane protease, serine 13a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0051219 CG31219 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0027930 MP1 "Melanization Protease 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E9PIJ5 TMPRSS13 "Transmembrane protease serine 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5J5 HABP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E9PRA0 TMPRSS13 "Transmembrane protease serine 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310872 Tmprss13 "transmembrane protease, serine 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0036738 CG7542 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:2682935 Tmprss13 "transmembrane protease, serine 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 2e-18
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 2e-18
pfam00089218 pfam00089, Trypsin, Trypsin 3e-15
COG5640 413 COG5640, COG5640, Secreted trypsin-like serine pro 3e-14
>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
 Score = 75.4 bits (186), Expect = 2e-18
 Identities = 28/55 (50%), Positives = 39/55 (70%), Gaps = 5/55 (9%)

Query: 23  GKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGI-GSPGIYTRITAYLPWI 76
           GKD+C GDSGGPLV  +    +  L+G+VS+G+  C   G PG+YTR+++YL WI
Sbjct: 179 GKDACQGDSGGPLVCNDG---RWVLVGIVSWGSG-CARPGKPGVYTRVSSYLDWI 229


Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues. Length = 229

>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
KOG3627|consensus256 99.8
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.67
COG5640 413 Secreted trypsin-like serine protease [Posttransla 99.65
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.51
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.47
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 97.57
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 96.65
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 94.65
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 92.17
PF05580218 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR 86.46
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 85.99
PRK10898 353 serine endoprotease; Provisional 85.79
PF02907148 Peptidase_S29: Hepatitis C virus NS3 protease; Int 82.85
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 82.67
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 80.53
PRK10139 455 serine endoprotease; Provisional 80.2
>KOG3627|consensus Back     alignment and domain information
Probab=99.80  E-value=1.8e-19  Score=116.11  Aligned_cols=75  Identities=41%  Similarity=0.821  Sum_probs=63.0

Q ss_pred             CCCCCCC--CCCCCeec-C--CCCCCCccCCCCcccEEEeCCCCeEEEEEEEeecCCCCCCCC-CcEEEeccccHHHHHH
Q psy17087          5 NDHKGDI--SVTETKFL-V--FPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGS-PGIYTRITAYLPWIIA   78 (84)
Q Consensus         5 ~~~~~~~--~i~~~~~C-~--~~~~~~C~gdsGgPl~~~~~~~~~~~l~Gi~s~~~~~C~~~~-p~v~t~v~~~~~WI~~   78 (84)
                      |...+..  .+++.||| +  ....++|+|||||||++....  +++++||+|||...|.... |++||+|+.|.+||++
T Consensus       175 C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~GDSGGPLv~~~~~--~~~~~GivS~G~~~C~~~~~P~vyt~V~~y~~WI~~  252 (256)
T KOG3627|consen  175 CRRAYGGLGTITDTMLCAGGPEGGKDACQGDSGGPLVCEDNG--RWVLVGIVSWGSGGCGQPNYPGVYTRVSSYLDWIKE  252 (256)
T ss_pred             hcccccCccccCCCEEeeCccCCCCccccCCCCCeEEEeeCC--cEEEEEEEEecCCCCCCCCCCeEEeEhHHhHHHHHH
Confidence            4444444  57778999 6  567788999999999998763  5999999999986699876 9999999999999999


Q ss_pred             Hhh
Q psy17087         79 RMA   81 (84)
Q Consensus        79 ~~~   81 (84)
                      .+.
T Consensus       253 ~~~  255 (256)
T KOG3627|consen  253 NIG  255 (256)
T ss_pred             Hhc
Confidence            875



>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
3tvj_B242 Catalytic Fragment Of Masp-2 In Complex With Its Sp 2e-10
1q3x_A328 Crystal Structure Of The Catalytic Region Of Human 3e-10
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 3e-10
4fxg_H242 Complement C4 In Complex With Masp-2 Length = 242 4e-10
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 1e-09
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 1e-09
2jet_C99 Crystal Structure Of A Trypsin-Like Mutant (S189d, 2e-09
1mtn_C97 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 2e-09
1afq_C96 Crystal Structure Of Bovine Gamma-Chymotrypsin Comp 2e-09
1kdq_B99 Crystal Structure Analysis Of The Mutant S189d Rat 5e-09
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 1e-08
2any_A241 Expression, Crystallization And The Three-Dimension 2e-08
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 2e-08
2anw_A241 Expression, Crystallization And Three-Dimensional S 2e-08
1eq9_A222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 2e-08
1fax_A254 Coagulation Factor Xa Inhibitor Complex Length = 25 3e-08
1ezq_A254 Crystal Structure Of Human Coagulation Factor Xa Co 3e-08
1c5m_D255 Structural Basis For Selectivity Of A Small Molecul 3e-08
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 5e-08
1mq5_A233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 5e-08
2y5f_A234 Factor Xa - Cation Inhibitor Complex Length = 234 5e-08
2bq6_B249 Crystal Structure Of Factor Xa In Complex With 21 L 6e-08
1fjs_A234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 6e-08
1xka_C235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 6e-08
1elv_A333 Crystal Structure Of The Catalytic Domain Of Human 6e-08
2bok_A241 Factor Xa- Cation Length = 241 6e-08
1hcg_A241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 6e-08
3ens_B238 Crystal Structure Of Human Fxa In Complex With Meth 6e-08
2olg_A278 Crystal Structure Of The Serine Protease Domain Of 7e-08
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 1e-07
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 1e-07
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 1e-07
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 1e-07
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 1e-07
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 1e-07
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 1e-07
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 1e-07
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 1e-07
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 1e-07
2gd4_H241 Crystal Structure Of The Antithrombin-S195a Factor 1e-07
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 1e-07
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 1e-07
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 1e-07
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 1e-07
1bda_A265 Catalytic Domain Of Human Single Chain Tissue Plasm 1e-07
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 1e-07
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 1e-07
1a5i_A265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 2e-07
1op0_A234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 3e-07
1op2_A234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 3e-07
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 3e-07
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 3e-07
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 3e-07
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 3e-07
1l2e_A223 Human Kallikrein 6 (Hk6) Active Form With Benzamidi 4e-07
1dst_A228 Mutant Of Factor D With Enhanced Catalytic Activity 5e-07
1pfx_C235 Porcine Factor Ixa Length = 235 5e-07
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 5e-07
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 5e-07
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 6e-07
1gvl_A223 Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P 6e-07
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 6e-07
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 6e-07
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 6e-07
4d8n_A223 Human Kallikrein 6 Inhibitors With A Para-Amidobenz 6e-07
4gso_A232 Structure Of Jararacussin-I Length = 232 6e-07
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 6e-07
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 7e-07
2qxg_A224 Crystal Structure Of Human Kallikrein 7 In Complex 7e-07
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 7e-07
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 7e-07
1lto_A245 Human Alpha1-Tryptase Length = 245 7e-07
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 7e-07
3bsq_A227 Crystal Structure Of Human Kallikrein 7 Produced As 7e-07
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 7e-07
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 7e-07
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 7e-07
1rtf_B252 Complex Of Benzamidine With The Catalytic Domain Of 8e-07
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 8e-07
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 9e-07
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 9e-07
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 9e-07
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 9e-07
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 9e-07
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 1e-06
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 1e-06
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 1e-06
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 1e-06
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 1e-06
2xxl_A408 Crystal Structure Of Drosophila Grass Clip Serine P 1e-06
3s69_A234 Crystal Structure Of Saxthrombin Length = 234 1e-06
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 1e-06
2xwa_A228 Crystal Structure Of Complement Factor D Mutant R20 1e-06
1kig_H241 Bovine Factor Xa Length = 241 1e-06
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 1e-06
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 1e-06
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 1e-06
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 1e-06
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 1e-06
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 1e-06
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 1e-06
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 1e-06
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 1e-06
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 1e-06
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 1e-06
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 1e-06
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 2e-06
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 2e-06
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 2e-06
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 2e-06
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 2e-06
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 2e-06
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 2e-06
4d9q_A228 Inhibiting Alternative Pathway Complement Activatio 2e-06
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 2e-06
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 2e-06
1dsu_A228 Human Factor D, Complement Activating Enzyme Length 2e-06
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 2e-06
1fdp_A235 Proenzyme Of Human Complement Factor D, Recombinant 2e-06
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 2e-06
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 2e-06
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 2e-06
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 2e-06
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 2e-06
2xrc_A565 Human Complement Factor I Length = 565 3e-06
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 3e-06
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 3e-06
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 3e-06
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 3e-06
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 3e-06
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 3e-06
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 3e-06
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 3e-06
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 3e-06
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 3e-06
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 3e-06
2xw9_A228 Crystal Structure Of Complement Factor D Mutant S18 3e-06
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 4e-06
1npm_A225 Neuropsin, A Serine Protease Expressed In The Limbi 4e-06
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 4e-06
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 4e-06
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 4e-06
3f6u_H240 Crystal Structure Of Human Activated Protein C (Apc 5e-06
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 5e-06
2a31_A223 Trypsin In Complex With Borate Length = 223 5e-06
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 5e-06
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 5e-06
1aut_C250 Human Activated Protein C Length = 250 5e-06
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 5e-06
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 5e-06
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 5e-06
2tbs_A222 Cold-Adaption Of Enzymes: Structural Comparison Bet 5e-06
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 6e-06
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 6e-06
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 6e-06
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 6e-06
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 7e-06
1bit_A237 The Crystal Structure Of Anionic Salmon Trypsin In 7e-06
1utj_A242 Trypsin Specificity As Elucidated By Lie Calculatio 7e-06
1mbq_A220 Anionic Trypsin From Pacific Chum Salmon Length = 2 7e-06
2zpq_A222 Crystal Structure Of Anionic Trypsin Isoform 1 From 8e-06
1uhb_B98 Crystal Structure Of Porcine Alpha Trypsin Bound Wi 8e-06
1ept_C98 Refined 1.8 Angstroms Resolution Crystal Structure 8e-06
1hj8_A222 1.00 Aa Trypsin From Atlantic Salmon Length = 222 8e-06
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 8e-06
2zpr_A222 Crystal Structure Of Anionic Trypsin Isoform 2 From 8e-06
1bzx_E222 The Crystal Structure Of Anionic Salmon Trypsin In 8e-06
1sgf_G237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 9e-06
2zps_A222 Crystal Structure Of Anionic Trypsin Isoform 3 From 9e-06
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 1e-05
1ym0_A238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 1e-05
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-05
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 1e-05
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 1e-05
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 1e-05
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-05
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 1e-05
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 1e-05
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 1e-05
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 1e-05
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 2e-05
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 2e-05
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 2e-05
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 2e-05
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 2e-05
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 2e-05
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 2e-05
1thp_B259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 2e-05
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 2e-05
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-05
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 2e-05
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 2e-05
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 2e-05
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 2e-05
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 2e-05
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 3e-05
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 3e-05
1hyl_A230 The 1.8 A Structure Of Collagenase From Hypoderma L 3e-05
2psx_A227 Crystal Structure Of Human Kallikrein 5 In Complex 3e-05
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 3e-05
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 4e-05
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 4e-05
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 5e-05
1dpo_A223 Structure Of Rat Trypsin Length = 223 5e-05
2zch_P237 Crystal Structure Of Human Prostate Specific Antige 6e-05
2aip_A231 Crystal Structure Of Native Protein C Activator Fro 7e-05
1twx_B259 Crystal Structure Of The Thrombin Mutant D221aD222K 7e-05
1mkw_K308 The Co-Crystal Structure Of Unliganded Bovine Alpha 8e-05
2kai_B152 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 8e-05
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 8e-05
1m9u_A241 Crystal Structure Of Earthworm Fibrinolytic Enzyme 9e-05
3nxp_A424 Crystal Structure Of Human Prethrombin-1 Length = 4 1e-04
1azz_A226 Fiddler Crab Collagenase Complexed To Ecotin Length 1e-04
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 1e-04
1vr1_H261 Specifity For Plasminogen Activator Inhibitor-1 Len 1e-04
4h4f_A249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 1e-04
1h9h_E231 Complex Of Eeti-Ii With Porcine Trypsin Length = 23 1e-04
1mza_A240 Crystal Structure Of Human Pro-Granzyme K Length = 2e-04
1wbg_B259 Active Site Thrombin Inhibitors Length = 259 2e-04
2od3_B259 Human Thrombin Chimera With Human Residues 184a, 18 2e-04
1jwt_A305 Crystal Structure Of Thrombin In Complex With A Nov 2e-04
1b7x_B259 Structure Of Human Alpha-Thrombin Y225i Mutant Boun 2e-04
1bth_H259 Structure Of Thrombin Complexed With Bovine Pancrea 2e-04
2ocv_B259 Structural Basis Of Na+ Activation Mimicry In Murin 2e-04
1nu9_A291 Staphylocoagulase-prethrombin-2 Complex Length = 29 2e-04
1gpz_A399 The Crystal Structure Of The Zymogen Catalytic Doma 2e-04
1hag_E295 The Isomorphous Structures Of Prethrombin2, Hirugen 2e-04
1mh0_A287 Crystal Structure Of The Anticoagulant Slow Form Of 2e-04
2thf_B259 Structure Of Human Alpha-thrombin Y225f Mutant Boun 2e-04
1d9i_A288 Structure Of Thrombin Complexed With Selective Non- 2e-04
2bdy_A289 Thrombin In Complex With Inhibitor Length = 289 2e-04
1d6w_A287 Structure Of Thrombin Complexed With Selective Non- 2e-04
3i77_A230 3599170-Loops Of Fxa In Sgt Length = 230 2e-04
2gp9_B259 Crystal Structure Of The Slow Form Of Thrombin In A 2e-04
1rd3_B259 2.5a Structure Of Anticoagulant Thrombin Variant E2 2e-04
1nm6_A287 Thrombin In Complex With Selective Macrocyclic Inhi 2e-04
1abi_H259 Structure Of The Hirulog 3-Thrombin Complex And Nat 2e-04
2bvr_H252 Human Thrombin Complexed With Fragment-based Small 2e-04
1dx5_M259 Crystal Structure Of The Thrombin-Thrombomodulin Co 2e-04
2hnt_F105 Crystallographic Structure Of Human Gamma-Thrombin 2e-04
1eoj_A289 Design Of P1' And P3' Residues Of Trivalent Thrombi 2e-04
3gic_B250 Structure Of Thrombin Mutant Delta(146-149e) In The 2e-04
3r3g_B259 Structure Of Human Thrombin With Residues 145-150 O 2e-04
1sfq_B259 Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack 2e-04
1vzq_H250 Complex Of Thrombin With Designed Inhibitor 7165 Le 2e-04
1h8i_H253 X-Ray Crystal Structure Of Human Alpha-Thrombin Wit 2e-04
2a0q_B257 Structure Of Thrombin In 400 Mm Potassium Chloride 2e-04
3jz1_B259 Crystal Structure Of Human Thrombin Mutant N143p In 2e-04
1qur_H257 Human Alpha-Thrombin In Complex With Bivalent, Benz 2e-04
1gj5_H258 Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 2e-04
2pks_C102 Thrombin In Complex With Inhibitor Length = 102 2e-04
2qy0_B242 Active Dimeric Structure Of The Catalytic Domain Of 2e-04
1spj_A238 Structure Of Mature Human Tissue Kallikrein (Human 3e-04
1h8d_H260 X-Ray Structure Of The Human Alpha-Thrombin Complex 3e-04
1id5_H256 Crystal Structure Of Bovine Thrombin Complex With P 3e-04
1os8_A223 Recombinant Streptomyces Griseus Trypsin Length = 2 3e-04
1bbr_K259 The Structure Of Residues 7-16 Of The A Alpha Chain 3e-04
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 3e-04
2eek_A220 Crystal Structure Of Atlantic Cod Trypsin Complexed 3e-04
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 3e-04
1bbr_E109 The Structure Of Residues 7-16 Of The A Alpha Chain 3e-04
1sgt_A223 Refined Crystal Structure Of Streptomyces Griseus T 3e-04
1ao5_A237 Mouse Glandular Kallikrein-13 (Prorenin Converting 3e-04
3k65_B308 Crystal Structure Of Prethombin-2FRAGMENT-2 Complex 4e-04
3sqe_E290 Crystal Structure Of Prethrombin-2 Mutant S195a In 4e-04
1jou_B259 Crystal Structure Of Native S195a Thrombin With An 4e-04
3rp2_A224 The Structure Of Rat Mast Cell Protease Ii At 1.9-A 4e-04
1dm4_B260 Ser195ala Mutant Of Human Thrombin Complexed With F 4e-04
3s9a_A234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 5e-04
1md8_A329 Monomeric Structure Of The Active Catalytic Domain 5e-04
2pux_B258 Crystal Structure Of Murine Thrombin In Complex Wit 5e-04
3ee0_B259 Crystal Structure Of The W215aE217A MUTANT OF HUMAN 5e-04
1euf_A227 Bovine Duodenase(New Serine Protease), Crystal Stru 5e-04
1tq0_B257 Crystal Structure Of The Potent Anticoagulant Throm 5e-04
1si5_H240 Protease-Like Domain From 2-Chain Hepatocyte Growth 6e-04
1shy_A234 The Crystal Structure Of Hgf Beta-Chain In Complex 6e-04
3edx_B258 Crystal Structure Of The W215aE217A MUTANT OF MURIN 6e-04
1oss_A223 T190p Streptomyces Griseus Trypsin In Complex With 7e-04
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 7e-04
1kyn_B235 Cathepsin-G Length = 235 7e-04
1z8i_B259 Crystal Structure Of The Thrombin Mutant G193a Boun 7e-04
1au8_A224 Human Cathepsin G Length = 224 8e-04
4e7n_A238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 9e-04
2b9l_A394 Crystal Structure Of Prophenoloxidase Activating Fa 9e-04
>pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 Back     alignment and structure

Iteration: 1

Score = 60.8 bits (146), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 27/55 (49%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Query: 23 GKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECG-IGSPGIYTRITAYLPWI 76 GKDSC GDSGG LV+ +++T + ++ G+VS+G+ CG G G+YT++ Y+PWI Sbjct: 181 GKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWI 235
>pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 Back     alignment and structure
>pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 Back     alignment and structure
>pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 Back     alignment and structure
>pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure
>pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 Back     alignment and structure
>pdb|3S69|A Chain A, Crystal Structure Of Saxthrombin Length = 234 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure
>pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 Back     alignment and structure
>pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 Back     alignment and structure
>pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 Back     alignment and structure
>pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 Back     alignment and structure
>pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 Back     alignment and structure
>pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 Back     alignment and structure
>pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 Back     alignment and structure
>pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 Back     alignment and structure
>pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 Back     alignment and structure
>pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 Back     alignment and structure
>pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 Back     alignment and structure
>pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 Back     alignment and structure
>pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 Back     alignment and structure
>pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 Back     alignment and structure
>pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 Back     alignment and structure
>pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 Back     alignment and structure
>pdb|3I77|A Chain A, 3599170-Loops Of Fxa In Sgt Length = 230 Back     alignment and structure
>pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure
>pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 Back     alignment and structure
>pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 Back     alignment and structure
>pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 Back     alignment and structure
>pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 Back     alignment and structure
>pdb|2HNT|F Chain F, Crystallographic Structure Of Human Gamma-Thrombin Length = 105 Back     alignment and structure
>pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 Back     alignment and structure
>pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 Back     alignment and structure
>pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 Back     alignment and structure
>pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 Back     alignment and structure
>pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 Back     alignment and structure
>pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 Back     alignment and structure
>pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 Back     alignment and structure
>pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 Back     alignment and structure
>pdb|2PKS|C Chain C, Thrombin In Complex With Inhibitor Length = 102 Back     alignment and structure
>pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 Back     alignment and structure
>pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 Back     alignment and structure
>pdb|1OS8|A Chain A, Recombinant Streptomyces Griseus Trypsin Length = 223 Back     alignment and structure
>pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|1BBR|E Chain E, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 109 Back     alignment and structure
>pdb|1SGT|A Chain A, Refined Crystal Structure Of Streptomyces Griseus Trypsin At 1.7 Angstroms Resolution Length = 223 Back     alignment and structure
>pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 Back     alignment and structure
>pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 Back     alignment and structure
>pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 Back     alignment and structure
>pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 Back     alignment and structure
>pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 Back     alignment and structure
>pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 Back     alignment and structure
>pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 Back     alignment and structure
>pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 Back     alignment and structure
>pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 Back     alignment and structure
>pdb|1SI5|H Chain H, Protease-Like Domain From 2-Chain Hepatocyte Growth Factor Length = 240 Back     alignment and structure
>pdb|1SHY|A Chain A, The Crystal Structure Of Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor Length = 234 Back     alignment and structure
>pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 Back     alignment and structure
>pdb|1OSS|A Chain A, T190p Streptomyces Griseus Trypsin In Complex With Benzamidine Length = 223 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|1KYN|B Chain B, Cathepsin-G Length = 235 Back     alignment and structure
>pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 1e-23
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 2e-23
2xxl_A408 GRAM-positive specific serine protease, isoform B; 3e-23
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 1e-22
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 5e-22
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 8e-22
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 4e-21
2qy0_B242 Complement C1R subcomponent; serine protease, beta 6e-21
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 7e-21
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 8e-21
2xw9_A228 Complement factor D; immune system, hydrolase, ser 8e-21
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 9e-21
1md8_A329 C1R complement serine protease; innate immunity, a 1e-20
1gpz_A399 Complement C1R component; hydrolase, activation, i 1e-20
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 3e-20
1elv_A333 Complement C1S component; trypsin-like serin prote 3e-20
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 3e-20
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 3e-20
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 9e-20
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 9e-20
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 1e-19
3bg8_A238 Coagulation factor XIA light chain; protease inhib 1e-19
1aut_C250 Activated protein C; serine proteinase, plasma cal 1e-19
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 1e-19
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 1e-19
2z7f_E218 Leukocyte elastase; serine protease, serine protea 1e-19
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 2e-19
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 2e-19
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 2e-19
2jde_A276 Urokinase-type plasminogen activator; plasminogen 2e-19
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 2e-19
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 2e-19
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 2e-19
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 3e-19
2r0l_A248 Hepatocyte growth factor activator; serine proteas 4e-19
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 4e-19
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 4e-19
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 5e-19
1a7s_A225 Heparin binding protein; serine protease homolog, 5e-19
1azz_A226 Collagenase; complex (serine protease/inhibitor), 5e-19
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 5e-19
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 5e-19
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 5e-19
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 5e-19
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 5e-19
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 6e-19
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 6e-19
1ao5_A237 Glandular kallikrein-13; serine protease, protein 6e-19
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 7e-19
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 7e-19
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 8e-19
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 9e-19
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 9e-19
2xrc_A565 Human complement factor I; immune system, hydrolas 1e-18
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 1e-18
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 1e-18
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 1e-18
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 1e-18
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 1e-18
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 1e-18
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 1e-18
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 2e-18
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 2e-18
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 2e-18
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 2e-18
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 2e-18
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 3e-18
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 3e-18
2asu_B234 Hepatocyte growth factor-like protein; serine prot 3e-18
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 3e-18
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 4e-18
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 5e-18
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 7e-18
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 8e-18
2aiq_A231 Protein C activator; snake venom serine proteinase 9e-18
3hrz_D741 Complement factor B; serine protease, glycosilated 1e-17
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 1e-17
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 1e-17
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 1e-17
1euf_A227 Duodenase; serine protease, dual specificity, hydr 1e-17
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 1e-17
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 1e-17
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 1e-17
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 2e-17
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 2e-17
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 2e-17
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 2e-17
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 2e-17
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 3e-17
2odp_A509 Complement C2; C3/C5 convertase, complement serin 1e-16
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 5e-15
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 1e-04
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 2e-04
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 3e-04
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 3e-04
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 5e-04
1hpg_A187 Glutamic acid specific protease; serine protease, 7e-04
2oua_A188 Serine protease, protein NAPA; kinetic stability, 8e-04
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
 Score = 89.7 bits (223), Expect = 1e-23
 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 23  GKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECG-IGSPGIYTRITAYLPWIIARM 80
            KDSC GDSGGPL+ +  + +  +L GLVS+G   CG  G PGIYT++  Y  WI   +
Sbjct: 220 AKDSCGGDSGGPLLAERANQQ-FFLEGLVSFG-ATCGTEGWPGIYTKVGKYRDWIEGNI 276


>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Length = 186 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Length = 189 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Length = 188 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.93
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.92
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.89
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.89
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.89
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.89
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.88
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.88
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.88
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.88
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.88
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.88
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.88
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.88
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.88
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.88
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.88
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.88
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.87
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.87
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.87
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.87
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.87
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.87
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.87
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.87
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.87
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.87
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.87
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.87
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.87
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.87
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.87
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.87
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.87
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.86
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.86
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.86
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.86
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.86
1md8_A329 C1R complement serine protease; innate immunity, a 99.86
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.86
1elv_A333 Complement C1S component; trypsin-like serin prote 99.86
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.85
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.85
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.85
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.85
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.85
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.85
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.85
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.85
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.85
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.85
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.84
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.84
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.84
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.84
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.84
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.84
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.84
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.84
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.83
2xrc_A565 Human complement factor I; immune system, hydrolas 99.83
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.83
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.83
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.83
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.83
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.83
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.83
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.83
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.82
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.82
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.82
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.82
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.82
2aiq_A231 Protein C activator; snake venom serine proteinase 99.82
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.82
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.82
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.81
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.81
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.81
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.81
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.8
3hrz_D741 Complement factor B; serine protease, glycosilated 99.8
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.8
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.79
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.79
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.79
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.78
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.78
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.76
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.76
1a7s_A225 Heparin binding protein; serine protease homolog, 99.76
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.73
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.56
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.45
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.41
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.22
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.15
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.11
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.09
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.07
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 98.64
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 98.63
1hpg_A187 Glutamic acid specific protease; serine protease, 98.62
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 98.38
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 98.3
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 98.23
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.99
2oua_A188 Serine protease, protein NAPA; kinetic stability, 97.94
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 97.7
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 97.47
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 97.47
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 97.46
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.22
1te0_A 318 Protease DEGS; two domains, serine protease, PDZ, 97.2
3k6y_A237 Serine protease, possible membrane-associated seri 97.17
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 97.14
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 96.75
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 96.7
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 96.69
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 96.46
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 96.31
3syj_A 1011 Adhesion and penetration protein autotransporter; 96.18
3h09_A 989 IGA1 protease, immunoglobulin A1 protease; serine 95.39
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 95.15
3sze_A 968 Serine protease ESPP; parallel beta-helix, hydrola 95.1
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 94.8
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 91.75
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 90.19
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 88.89
2w5e_A163 Putative serine protease; coiled coil, transmembra 87.84
2hrv_A142 2A cysteine proteinase; hydrolase (cysteine protei 84.96
1z8r_A166 Coxsackievirus B4 polyprotein; beta barrel coordin 84.82
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 84.22
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 80.08
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
Probab=99.93  E-value=3.8e-27  Score=133.08  Aligned_cols=71  Identities=38%  Similarity=0.704  Sum_probs=61.1

Q ss_pred             CCCCCCCeec-CCCCCCCccCCCCcccEEEeCCCCeEEEEEEEeecCCCCCCCC-CcEEEeccccHHHHHHHhhhc
Q psy17087         10 DISVTETKFL-VFPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPECGIGS-PGIYTRITAYLPWIIARMAYE   83 (84)
Q Consensus        10 ~~~i~~~~~C-~~~~~~~C~gdsGgPl~~~~~~~~~~~l~Gi~s~~~~~C~~~~-p~v~t~v~~~~~WI~~~~~~~   83 (84)
                      ...+++.||| +..+.++|+|||||||++... + +|+|+||+||+.. |.... |+|||||+.|++||+++++.+
T Consensus        25 ~~~i~~~~iCa~~~~~~~C~GDSGGPL~~~~~-~-~~~l~GIvS~g~~-c~~~~~p~vyt~V~~y~~WI~~~~~~n   97 (97)
T 1yph_E           25 GTKIKDAMICAGASGVSSCMGDSGGPLVCKKN-G-AWTLVGIVSWGSS-TCSTSTPGVYARVTALVNWVQQTLAAN   97 (97)
T ss_dssp             GGGCCTTEEEEECSSCBCCTTCTTCEEEEEET-T-EEEEEEEEEECCT-TCCTTSEEEEEEHHHHHHHHHHHHHHC
T ss_pred             cCCCCCceEeecCCCCCCCcCCCCCcEEEEeC-C-eEEEEEEEEeCCC-CCCCCCCeEEEEHHHhHHHHHHHHccC
Confidence            3458899999 766679999999999999864 4 4999999999987 76555 999999999999999998754



>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>3h09_A IGA1 protease, immunoglobulin A1 protease; serine protease, beta helix, hydrolase, M protease, secreted, transmembrane, virulence; 1.75A {Haemophilus influenzae} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3sze_A Serine protease ESPP; parallel beta-helix, hydrolase; 2.50A {Escherichia coli O157} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2hrv_A 2A cysteine proteinase; hydrolase (cysteine proteinase); 1.95A {Human rhinovirus 2} SCOP: b.47.1.4 Back     alignment and structure
>1z8r_A Coxsackievirus B4 polyprotein; beta barrel coordinated zinc ION, hydrolase; NMR {Human coxsackievirus B4} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 1e-16
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 4e-16
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 1e-15
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 1e-15
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 2e-15
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 2e-15
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 4e-15
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 3e-14
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 5e-14
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 8e-14
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 1e-13
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 2e-13
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 2e-13
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 2e-13
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 3e-13
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 4e-13
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 5e-13
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 5e-13
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 5e-13
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 1e-12
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 1e-12
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 1e-12
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 2e-12
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 2e-12
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 2e-12
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 2e-12
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 2e-12
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 3e-12
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 7e-12
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 9e-12
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 1e-11
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 1e-11
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 1e-11
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 1e-11
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 2e-11
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 3e-11
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 4e-11
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 6e-11
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 6e-11
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 6e-11
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 7e-11
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 1e-10
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 1e-10
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 1e-10
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 8e-10
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 2e-09
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 3e-09
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 4e-09
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 6e-09
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 6e-09
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9e-09
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 1e-08
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 1e-08
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 2e-08
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 3e-08
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 3e-08
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 3e-08
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 3e-07
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 2e-06
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 0.002
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.82
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.82
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.81
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.81
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.81
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.8
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.8
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.8
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.8
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.8
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.8
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.79
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.79
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.79
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.78
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.78
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.77
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.77
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 99.77
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.77
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.77
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 99.77
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.77
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.76
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.76
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.76
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.76
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.75
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.75
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.74
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.74
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.74
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.73
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.72
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.72
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.71
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.71
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.68
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.68
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.66
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.64
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.61
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 99.56
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.37
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 98.95
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 98.93
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 97.93
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 97.91
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 97.09
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 96.98
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 96.37
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 95.06
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 94.64
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 93.71
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 93.62
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 93.1
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 92.32
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 92.03
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 91.7
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Factor B
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=6.5e-21  Score=122.08  Aligned_cols=74  Identities=26%  Similarity=0.553  Sum_probs=58.0

Q ss_pred             CCCCCCCCCeec-C----CCCCCCccCCCCcccEEEeCCCCeEEEEEEEeecCCC-CC--------CCC-CcEEEecccc
Q psy17087          8 KGDISVTETKFL-V----FPGKDSCNGDSGGPLVWKNNDTRKHYLIGLVSYGTPE-CG--------IGS-PGIYTRITAY   72 (84)
Q Consensus         8 ~~~~~i~~~~~C-~----~~~~~~C~gdsGgPl~~~~~~~~~~~l~Gi~s~~~~~-C~--------~~~-p~v~t~v~~~   72 (84)
                      .....++++||| +    ..+.++|.|||||||++..+ +. |+|+||+|||... |.        ... |.|||||+.|
T Consensus       194 ~~~~~i~~~~~Cag~~~~~~~~~~C~GDSGgPL~~~~~-~~-~~lvGI~S~G~~~~~~~~~~~~~~~~~~~~vyt~V~~y  271 (287)
T d1rrka1         194 DISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKR-SR-FIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQV  271 (287)
T ss_dssp             CGGGTSCTTEEEEESSSSSCCCCCCGGGTTCEEEEEET-TE-EEEEEEEEEESCCCC--------CCTTCEEEEEEGGGG
T ss_pred             cccccccCCceEecccCCCcCCCCCCCCccCCeEEecC-Ce-EEEEEEEEecCCcCcCCCCCCCcCCCCCCcEEEEHHHH
Confidence            334567899999 5    33567899999999999865 44 9999999997531 32        123 7899999999


Q ss_pred             HHHHHHHhhhc
Q psy17087         73 LPWIIARMAYE   83 (84)
Q Consensus        73 ~~WI~~~~~~~   83 (84)
                      ++||+++|+++
T Consensus       272 ~~WI~~~i~~~  282 (287)
T d1rrka1         272 LPWLKEKLQDE  282 (287)
T ss_dssp             HHHHHHHTTTS
T ss_pred             HHHHHHHhcCC
Confidence            99999999864



>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure