Psyllid ID: psy1708
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 482 | ||||||
| 340723208 | 742 | PREDICTED: cytochrome P450 6k1-like [Bom | 0.927 | 0.602 | 0.355 | 2e-86 | |
| 340723206 | 717 | PREDICTED: cytochrome P450 6k1-like [Bom | 0.923 | 0.620 | 0.350 | 7e-85 | |
| 350418750 | 683 | PREDICTED: cytochrome P450 6k1-like [Bom | 0.802 | 0.566 | 0.356 | 2e-78 | |
| 408724255 | 519 | cytochrome P450 CYP6BD10v2 [Laodelphax s | 0.514 | 0.477 | 0.521 | 3e-75 | |
| 380021345 | 711 | PREDICTED: probable cytochrome P450 6a14 | 0.929 | 0.630 | 0.342 | 2e-74 | |
| 339896293 | 491 | cytochrome P450 [Bemisia tabaci] | 0.526 | 0.517 | 0.458 | 8e-68 | |
| 291464103 | 513 | cytochrome P450 354A5 [Manduca sexta] | 0.589 | 0.553 | 0.426 | 9e-55 | |
| 433338929 | 516 | cytochrome P450 [Bombyx mori] gi|4333389 | 0.497 | 0.465 | 0.433 | 1e-54 | |
| 433338927 | 516 | cytochrome P450 [Bombyx mori] | 0.497 | 0.465 | 0.437 | 3e-54 | |
| 91094059 | 506 | PREDICTED: similar to cytochrome P450 is | 0.456 | 0.434 | 0.434 | 5e-52 |
| >gi|340723208|ref|XP_003399986.1| PREDICTED: cytochrome P450 6k1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 326 bits (835), Expect = 2e-86, Method: Compositional matrix adjust.
Identities = 170/478 (35%), Positives = 274/478 (57%), Gaps = 31/478 (6%)
Query: 11 KRVILFMIIVFIPMFARFIPLSLFNSRVMEYLVALSKKVAHMRKTEGVRRNDFLQLMVEH 70
+R + F+ I F+P ++F+ F + +L ++ + R G +RND + ++ E
Sbjct: 226 ERNMDFLTITFMPQLSKFLKPKFFGKKATNFLRSVFWDMIEQRDNSGQKRNDLIDVLTEI 285
Query: 71 QDDSNAPSDDVIKVKTVTVGENGETKQKVFLSEDTVTAQSILFLIAGYETSSTLLMFASY 130
++ T + K F ED V AQ+ +F AG+ETS+ + F Y
Sbjct: 286 RE---------------TYKNDERLKNYRFDGEDLV-AQAAIFFAAGFETSAATMSFTLY 329
Query: 131 QLSLNVDIQDKLRAHVNEILDKHGGKCTYEALQDMSYLEMVLNETLRMHPSVARVDRHCT 190
+L+LN DIQ LRA +++ L+++ GK TY + + YL+MV++ETLR +PSV ++R
Sbjct: 330 ELALNTDIQKTLRAEIHDALEENDGKITYNMITTLPYLDMVISETLRKYPSVPNLNRVTL 389
Query: 191 LDYTLPDTNIVIRAGESVNVPIMGLHYDPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFG 250
DY +PD+++VI+ G + + I+ LHYD +Y+P+P K+DP RF E K+ R +LPFG
Sbjct: 390 ADYKVPDSDLVIQKGTPIFISIVALHYDSRYFPNPEKYDPLRFTEEAKSNRPSSAYLPFG 449
Query: 251 AGPRNCIGNTTWIFS------------EMSENKRNDFLQLMVEHQDDSNAPSD---DVIK 295
AGPR C+G + E+S ++ ++ + S A ++ K
Sbjct: 450 AGPRICLGMRLGLMQAKLGVVQILKDYEVSPCEKTKIPIVLDPNAVISTALGGVHLNIRK 509
Query: 296 VKTVTVGENGETKQKVFLSEDTVTAQSILFLIAGYETSSTLLMFASYQLSLNVDIQDKLR 355
T + TK + D + AQ+ + AG+ETSST + F Y+L+LN D+Q KLR
Sbjct: 510 TTTAIYFISESTKFRPNFDGDDLLAQAAILFAAGFETSSTTMSFTLYELALNPDVQKKLR 569
Query: 356 AHVNEILDKHGGKCTYEALQDMSYLEMVLNETLRMHPSVARVDRHCTLDYTLPDTNIVIR 415
A + + L++ GGK TY+ + + YL+MV++E+LR +P+VA +DR DY +P++++VI
Sbjct: 570 AEIQDALEETGGKITYDMITTLPYLDMVVSESLRKYPAVAYMDRISLADYKVPNSDLVIE 629
Query: 416 AGESVNVPIMGLHYDPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFGAGPRNCIGFKI 473
G + + IMGLHYD +Y+P+P K+DP RF E K+ R + +LPFG GPR CIG ++
Sbjct: 630 KGTPIFISIMGLHYDSRYFPNPEKYDPLRFTEEAKSNRPSFAYLPFGGGPRGCIGMRL 687
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340723206|ref|XP_003399985.1| PREDICTED: cytochrome P450 6k1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350418750|ref|XP_003491954.1| PREDICTED: cytochrome P450 6k1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|408724255|gb|AFU86445.1| cytochrome P450 CYP6BD10v2 [Laodelphax striatella] | Back alignment and taxonomy information |
|---|
| >gi|380021345|ref|XP_003694529.1| PREDICTED: probable cytochrome P450 6a14-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|339896293|gb|AEK21832.1| cytochrome P450 [Bemisia tabaci] | Back alignment and taxonomy information |
|---|
| >gi|291464103|gb|ADE05589.1| cytochrome P450 354A5 [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|433338929|dbj|BAM73820.1| cytochrome P450 [Bombyx mori] gi|433338931|dbj|BAM73821.1| cytochrome P450 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|433338927|dbj|BAM73819.1| cytochrome P450 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|91094059|ref|XP_966437.1| PREDICTED: similar to cytochrome P450 isoform 1 [Tribolium castaneum] gi|270016187|gb|EFA12635.1| cytochrome P450 6BK3 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 482 | ||||||
| FB|FBgn0039519 | 507 | Cyp6a18 "Cyp6a18" [Drosophila | 0.460 | 0.437 | 0.367 | 1.3e-36 | |
| FB|FBgn0013772 | 506 | Cyp6a8 "Cytochrome P450-6a8" [ | 0.570 | 0.543 | 0.333 | 1.5e-35 | |
| FB|FBgn0033978 | 502 | Cyp6a23 "Cyp6a23" [Drosophila | 0.331 | 0.318 | 0.418 | 5.8e-34 | |
| FB|FBgn0033304 | 493 | Cyp6a13 "Cyp6a13" [Drosophila | 0.400 | 0.391 | 0.350 | 1.8e-32 | |
| FB|FBgn0038194 | 508 | Cyp6d5 "Cyp6d5" [Drosophila me | 0.462 | 0.438 | 0.324 | 1.1e-31 | |
| FB|FBgn0039006 | 515 | Cyp6d4 "Cyp6d4" [Drosophila me | 0.489 | 0.458 | 0.323 | 1.3e-31 | |
| FB|FBgn0000473 | 506 | Cyp6a2 "Cytochrome P450-6a2" [ | 0.479 | 0.456 | 0.321 | 3e-31 | |
| FB|FBgn0033979 | 503 | Cyp6a19 "Cyp6a19" [Drosophila | 0.331 | 0.318 | 0.412 | 4.2e-31 | |
| FB|FBgn0013771 | 504 | Cyp6a9 "Cytochrome P450-6a9" [ | 0.466 | 0.446 | 0.331 | 8.9e-31 | |
| FB|FBgn0033981 | 504 | Cyp6a21 "Cyp6a21" [Drosophila | 0.458 | 0.438 | 0.312 | 3.4e-30 |
| FB|FBgn0039519 Cyp6a18 "Cyp6a18" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 394 (143.8 bits), Expect = 1.3e-36, P = 1.3e-36
Identities = 87/237 (36%), Positives = 136/237 (57%)
Query: 23 PMFARFIPLSLFNSRVMEYLVALSKKVAHMRKTEGVRRNDFLQLMVEHQDDSNAPSDDVI 82
P AR + L +++ E+ + K+ +R+ E ++RNDF+ +++ ++ N
Sbjct: 231 PNLARRLGLCRNTAQIQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKN------- 283
Query: 83 KVKTVTVGENGETKQKVFLSEDTVTAQSILFLIAGYETSSTLLMFASYQLSLNVDIQDKL 142
+T+ ENGE + L+ D + AQ+ +F IAG++TSS+ + FA Y+L+ N IQDK+
Sbjct: 284 ----MTL-ENGEVVKG--LTMDEIVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKV 336
Query: 143 RAHVNEILDKHGGKCTYEALQDMSYLEMVLNETLRMHPSVARVDRHCTLDYTLP-DTNIV 201
RA + ++L++H K TYE ++D+ YL+ V+NETLR + V VDR + +P + V
Sbjct: 337 RAELGQVLEQHDQKFTYECIKDLKYLDQVINETLRHYTIVPNVDRVAAKRFVVPGNPKFV 396
Query: 202 IRAGESVNVPIMGLHXXXXXXXXXXXXXXXRFLPEEKAKRSPYVFLPFGAGPRNCIG 258
I AG+SV +P +H RF PEE AKR +LPFG GPRNCIG
Sbjct: 397 IEAGQSVIIPSSAIHHDPSIYPEPNEFRPERFSPEESAKRPSVAWLPFGEGPRNCIG 453
|
|
| FB|FBgn0013772 Cyp6a8 "Cytochrome P450-6a8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033978 Cyp6a23 "Cyp6a23" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033304 Cyp6a13 "Cyp6a13" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038194 Cyp6d5 "Cyp6d5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039006 Cyp6d4 "Cyp6d4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000473 Cyp6a2 "Cytochrome P450-6a2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033979 Cyp6a19 "Cyp6a19" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013771 Cyp6a9 "Cytochrome P450-6a9" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033981 Cyp6a21 "Cyp6a21" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 482 | |||
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 5e-49 | |
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 6e-48 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 4e-32 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 1e-31 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 4e-23 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 8e-23 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 4e-19 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 5e-19 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 6e-19 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 2e-18 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 2e-18 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 4e-18 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 9e-17 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 9e-17 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 8e-15 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 8e-15 | |
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 3e-14 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 4e-14 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 1e-13 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 1e-13 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 1e-13 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 1e-13 | |
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 2e-13 | |
| PLN02987 | 472 | PLN02987, PLN02987, Cytochrome P450, family 90, su | 2e-13 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 3e-13 | |
| PLN02966 | 502 | PLN02966, PLN02966, cytochrome P450 83A1 | 6e-13 | |
| PLN02987 | 472 | PLN02987, PLN02987, Cytochrome P450, family 90, su | 9e-13 | |
| PLN02774 | 463 | PLN02774, PLN02774, brassinosteroid-6-oxidase | 9e-13 | |
| PLN02774 | 463 | PLN02774, PLN02774, brassinosteroid-6-oxidase | 9e-13 | |
| PLN02966 | 502 | PLN02966, PLN02966, cytochrome P450 83A1 | 2e-12 | |
| PLN00110 | 504 | PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F | 4e-12 | |
| PLN00110 | 504 | PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F | 5e-12 | |
| PLN02426 | 502 | PLN02426, PLN02426, cytochrome P450, family 94, su | 1e-10 | |
| PLN02426 | 502 | PLN02426, PLN02426, cytochrome P450, family 94, su | 1e-10 | |
| PLN03112 | 514 | PLN03112, PLN03112, cytochrome P450 family protein | 4e-10 | |
| PLN02183 | 516 | PLN02183, PLN02183, ferulate 5-hydroxylase | 8e-10 | |
| PLN02183 | 516 | PLN02183, PLN02183, ferulate 5-hydroxylase | 1e-09 | |
| PLN03112 | 514 | PLN03112, PLN03112, cytochrome P450 family protein | 2e-09 | |
| PLN02648 | 480 | PLN02648, PLN02648, allene oxide synthase | 2e-09 | |
| PLN02648 | 480 | PLN02648, PLN02648, allene oxide synthase | 2e-09 | |
| PLN03018 | 534 | PLN03018, PLN03018, homomethionine N-hydroxylase | 3e-09 | |
| PLN02500 | 490 | PLN02500, PLN02500, cytochrome P450 90B1 | 1e-08 | |
| PLN02500 | 490 | PLN02500, PLN02500, cytochrome P450 90B1 | 1e-08 | |
| PLN03018 | 534 | PLN03018, PLN03018, homomethionine N-hydroxylase | 2e-08 | |
| PLN02196 | 463 | PLN02196, PLN02196, abscisic acid 8'-hydroxylase | 3e-08 | |
| PLN02196 | 463 | PLN02196, PLN02196, abscisic acid 8'-hydroxylase | 4e-07 | |
| PLN02169 | 500 | PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla | 6e-07 | |
| PLN02169 | 500 | PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla | 6e-07 | |
| PLN03141 | 452 | PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m | 1e-06 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 1e-06 | |
| PLN03141 | 452 | PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m | 3e-06 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 4e-06 | |
| PLN02971 | 543 | PLN02971, PLN02971, tryptophan N-hydroxylase | 3e-04 | |
| PLN02971 | 543 | PLN02971, PLN02971, tryptophan N-hydroxylase | 3e-04 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
Score = 174 bits (442), Expect = 5e-49
Identities = 72/247 (29%), Positives = 124/247 (50%), Gaps = 32/247 (12%)
Query: 19 IVFIPMFARFIPLSLF------NSRVMEYLVALSKKVAHMRKTEGVRRNDFLQLMVEHQD 72
++ + ++ P ++ + L L ++ + DFL ++ ++
Sbjct: 191 LLDLFPILKYFPGPHGRKLKRARKKIKDLLDKLIEERRETLDSAKKSPRDFLDALLLAKE 250
Query: 73 DSNAPSDDVIKVKTVTVGENGETKQKVFLSEDTVTAQSILFLIAGYETSSTLLMFASYQL 132
+ E+G L+++ + A + AG +T+S+ L +A Y+L
Sbjct: 251 E-----------------EDGSK-----LTDEELRATVLELFFAGTDTTSSTLSWALYEL 288
Query: 133 SLNVDIQDKLRAHVNEILDKHGGKCTYEALQDMSYLEMVLNETLRMHPSVA-RVDRHCTL 191
+ + ++Q+KLR ++E++ TY+ LQ+M YL+ V+ ETLR+HP V + R T
Sbjct: 289 AKHPEVQEKLREEIDEVIGDKR-SPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTK 347
Query: 192 DYTLPDTNIVIRAGESVNVPIMGLHYDPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFGA 251
D +P +I G V V + LH DP+ +P+P +FDP+RFL E R + FLPFGA
Sbjct: 348 DTVIPG--YLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGA 405
Query: 252 GPRNCIG 258
GPRNC+G
Sbjct: 406 GPRNCLG 412
|
Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| KOG0158|consensus | 499 | 100.0 | ||
| KOG0158|consensus | 499 | 100.0 | ||
| KOG0156|consensus | 489 | 100.0 | ||
| KOG0156|consensus | 489 | 100.0 | ||
| PLN02500 | 490 | cytochrome P450 90B1 | 100.0 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 100.0 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 100.0 | |
| KOG0159|consensus | 519 | 100.0 | ||
| PLN02774 | 463 | brassinosteroid-6-oxidase | 100.0 | |
| KOG0157|consensus | 497 | 100.0 | ||
| PLN02971 | 543 | tryptophan N-hydroxylase | 100.0 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 100.0 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 100.0 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 100.0 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 100.0 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 100.0 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 100.0 | |
| KOG0159|consensus | 519 | 100.0 | ||
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 100.0 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 100.0 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 100.0 | |
| KOG0157|consensus | 497 | 100.0 | ||
| PLN00168 | 519 | Cytochrome P450; Provisional | 100.0 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 100.0 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 100.0 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 100.0 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 100.0 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 100.0 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 100.0 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 100.0 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 100.0 | |
| PLN02655 | 466 | ent-kaurene oxidase | 100.0 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 100.0 | |
| KOG0684|consensus | 486 | 100.0 | ||
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 100.0 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 100.0 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 100.0 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 100.0 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 100.0 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 100.0 | |
| PLN02655 | 466 | ent-kaurene oxidase | 100.0 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 100.0 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 100.0 | |
| KOG0684|consensus | 486 | 100.0 | ||
| PLN02290 | 516 | cytokinin trans-hydroxylase | 100.0 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 100.0 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 100.0 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 100.0 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 100.0 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 100.0 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 100.0 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 100.0 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 100.0 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 100.0 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 100.0 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 100.0 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 100.0 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 100.0 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 100.0 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 100.0 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 100.0 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 100.0 | |
| PLN02648 | 480 | allene oxide synthase | 99.97 | |
| PLN02648 | 480 | allene oxide synthase | 99.96 |
| >KOG0158|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.3e-46 Score=365.37 Aligned_cols=234 Identities=40% Similarity=0.766 Sum_probs=208.1
Q ss_pred HHHHHHhhHHHhhccCccccHHHHHHHHHHHHHHHHHHHhcCCCcchHHHHHHHHhcCCCCCCccchhhhhccccCCCCc
Q psy1708 16 FMIIVFIPMFARFIPLSLFNSRVMEYLVALSKKVAHMRKTEGVRRNDFLQLMVEHQDDSNAPSDDVIKVKTVTVGENGET 95 (482)
Q Consensus 16 ~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~d~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 95 (482)
+.....+|.+...+....+.....+++..++...++.|...+..++|+++.+++.+.+....+ ...
T Consensus 222 ~~~~~~~p~l~~~l~~~~~~~~~~~~~~~~v~~~v~~R~~~~~~r~Dfi~lll~~~~~~~~~~--------------~~~ 287 (499)
T KOG0158|consen 222 FMLIFLFPKLALPLRVKLFPEDVTDFFRKLVNSRVEQREKENIERNDFIDLLLDARASDFAKS--------------KSH 287 (499)
T ss_pred HhHHHHhHHHHHhhhcccChHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHhhccccccc--------------ccc
Confidence 445566777777776777778889999999999999997777888999999999876411110 000
Q ss_pred ccccCCCHHHHHHHHHHHHHhchhhHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHhhCCCCCChhhhccChHHHHHHhhh
Q psy1708 96 KQKVFLSEDTVTAQSILFLIAGYETSSTLLMFASYQLSLNVDIQDKLRAHVNEILDKHGGKCTYEALQDMSYLEMVLNET 175 (482)
Q Consensus 96 ~~~~~l~~~~i~~~~~~l~~ag~~tt~~~l~~~l~~L~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~~l~~l~a~i~E~ 175 (482)
+ .+|.++|+++++.+++||.||||+++++++|+|++||++|+|||+||+++..+..+ ++++.+.+|+||++||+||
T Consensus 288 ~---~lt~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~-ltyd~l~~L~YLd~Vi~ET 363 (499)
T KOG0158|consen 288 K---ALTDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEG-LTYDSLSKLKYLDMVIKET 363 (499)
T ss_pred c---ccCHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCC-CCHHHHhCCcHHHHHHHHH
Confidence 0 39999999999999999999999999999999999999999999999999766544 9999999999999999999
Q ss_pred cCCCCCCCccccccccccccCCCceeecCCcEEEEcchhcccCCCCCCCCCCCCCCCCCCcccCCCCCccccccCCCCcc
Q psy1708 176 LRMHPSVARVDRHCTLDYTLPDTNIVIRAGESVNVPIMGLHYDPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFGAGPRN 255 (482)
Q Consensus 176 lRl~p~~~~~~r~~~~~~~~~~~~~~ip~G~~v~~~~~~~~~d~~~~~~p~~f~p~Rfl~~~~~~~~~~~~~~Fg~g~~~ 255 (482)
||+||+++.+.|.+++|+++++ ++.||||+.|.++.+++||||++||||++|+||||.+++.+...+.+|+|||.|||.
T Consensus 364 LR~yP~~~~~~R~C~k~~~i~~-~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~ 442 (499)
T KOG0158|consen 364 LRLYPPAPFLNRECTKDYEIPG-GFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRN 442 (499)
T ss_pred HhhCCCcccccceecCceecCC-CeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCcccccCCccccCCCCCccc
Confidence 9999999999999999999997 899999999999999999999999999999999999888777788999999999999
Q ss_pred cccchhhHHhhhh
Q psy1708 256 CIGNTTWIFSEMS 268 (482)
Q Consensus 256 C~g~~~~~~~~~~ 268 (482)
|+|.+++.++.+.
T Consensus 443 CIGmRfa~mq~K~ 455 (499)
T KOG0158|consen 443 CIGMRFALMEAKL 455 (499)
T ss_pred cHHHHHHHHHHHH
Confidence 9999999998876
|
|
| >KOG0158|consensus | Back alignment and domain information |
|---|
| >KOG0156|consensus | Back alignment and domain information |
|---|
| >KOG0156|consensus | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >KOG0159|consensus | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >KOG0157|consensus | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >KOG0159|consensus | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >KOG0157|consensus | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >KOG0684|consensus | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >KOG0684|consensus | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 482 | ||||
| 1tqn_A | 486 | Crystal Structure Of Human Microsomal P450 3a4 Leng | 2e-28 | ||
| 1w0e_A | 485 | Crystal Structure Of Human Cytochrome P450 3a4 Leng | 2e-28 | ||
| 3ua1_A | 487 | Crystal Structure Of The Cytochrome P4503a4-Bromoer | 2e-28 | ||
| 3cbd_A | 455 | Directed Evolution Of Cytochrome P450 Bm3, To Octan | 2e-12 | ||
| 1zoa_A | 473 | Crystal Structure Of A328v Mutant Of The Heme Domai | 8e-12 | ||
| 3npl_A | 470 | Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D | 2e-11 | ||
| 3qi8_B | 472 | Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) | 2e-11 | ||
| 3ben_A | 470 | Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine | 2e-11 | ||
| 2uwh_A | 458 | Cytochrome P450 Bm3 Mutant In Complex With Palmitic | 2e-11 | ||
| 2nnb_A | 471 | The Q403k Mutnat Heme Domain Of Flavocytochrome P45 | 2e-11 | ||
| 3kx3_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 2e-11 | ||
| 1bvy_A | 458 | Complex Of The Heme And Fmn-Binding Domains Of The | 2e-11 | ||
| 2hpd_A | 471 | Crystal Structure Of Hemoprotein Domain Of P450bm-3 | 2e-11 | ||
| 2ij2_A | 470 | Atomic Structure Of The Heme Domain Of Flavocytochr | 2e-11 | ||
| 1jpz_A | 473 | Crystal Structure Of A Complex Of The Heme Domain O | 2e-11 | ||
| 2bmh_A | 455 | Modeling Protein-Substrate Interactions In The Heme | 2e-11 | ||
| 2x7y_A | 455 | P450 Bm3 F87a In Complex With Dmso Length = 455 | 2e-11 | ||
| 3m4v_A | 482 | Crystal Structure Of The A330p Mutant Of Cytochrome | 3e-11 | ||
| 1zo4_A | 473 | Crystal Structure Of A328s Mutant Of The Heme Domai | 4e-11 | ||
| 2ve3_A | 444 | Retinoic Acid Bound Cyanobacterial Cyp120a1 Length | 4e-11 | ||
| 2ve3_A | 444 | Retinoic Acid Bound Cyanobacterial Cyp120a1 Length | 9e-09 | ||
| 4duf_A | 471 | Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto | 5e-11 | ||
| 4duc_A | 472 | Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng | 5e-11 | ||
| 4dud_A | 471 | Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le | 5e-11 | ||
| 1p0x_A | 455 | F393y Mutant Heme Domain Of Flavocytochrome P450 Bm | 5e-11 | ||
| 1p0w_A | 455 | F393w Mutant Heme Domain Of Flavocytochrome P450 Bm | 6e-11 | ||
| 3psx_A | 487 | Crystal Structure Of The Kt2 Mutant Of Cytochrome P | 7e-11 | ||
| 1yqp_A | 455 | T268n Mutant Cytochrome Domain Of Flavocytochrome P | 7e-11 | ||
| 1yqo_A | 455 | T268a Mutant Heme Domain Of Flavocytochrome P450 Bm | 8e-11 | ||
| 3dgi_A | 461 | Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le | 8e-11 | ||
| 1fah_A | 471 | Structure Of Cytochrome P450 Length = 471 | 8e-11 | ||
| 3ekb_A | 470 | Crystal Structure Of The A264c Mutant Heme Domain O | 8e-11 | ||
| 3ekf_A | 470 | Crystal Structure Of The A264q Heme Domain Of Cytoc | 8e-11 | ||
| 2ij4_A | 470 | Structure Of The A264k Mutant Of Cytochrome P450 Bm | 9e-11 | ||
| 1smi_A | 471 | A Single Mutation Of P450 Bm3 Induces The Conformat | 9e-11 | ||
| 3ekd_A | 470 | Crystal Structure Of The A264m Heme Domain Of Cytoc | 1e-10 | ||
| 2ij3_A | 470 | Structure Of The A264h Mutant Of Cytochrome P450 Bm | 1e-10 | ||
| 3hf2_A | 482 | Crystal Structure Of The I401p Mutant Of Cytochrome | 1e-10 | ||
| 3kx4_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 2e-10 | ||
| 1jme_A | 455 | Crystal Structure Of Phe393his Cytochrome P450 Bm3 | 2e-10 | ||
| 1p0v_A | 455 | F393a Mutant Heme Domain Of Flavocytochrome P450 Bm | 2e-10 | ||
| 3kx5_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 3e-10 | ||
| 3k9v_A | 482 | Crystal Structure Of Rat Mitochondrial P450 24a1 S5 | 4e-10 | ||
| 4dub_A | 472 | Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami | 6e-10 | ||
| 4dua_A | 471 | Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng | 6e-10 | ||
| 4dtw_B | 469 | Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto | 7e-10 | ||
| 4du2_B | 470 | Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin | 3e-09 | ||
| 3ld6_A | 461 | Crystal Structure Of Human Lanosterol 14alpha-Demet | 8e-09 | ||
| 3ld6_A | 461 | Crystal Structure Of Human Lanosterol 14alpha-Demet | 8e-09 | ||
| 3dbg_A | 467 | Crystal Structure Of Cytochrome P450 170a1 (Cyp170a | 1e-07 | ||
| 3dbg_A | 467 | Crystal Structure Of Cytochrome P450 170a1 (Cyp170a | 9e-06 | ||
| 3n9y_A | 487 | Crystal Structure Of Human Cyp11a1 In Complex With | 2e-07 | ||
| 3na0_A | 471 | Crystal Structure Of Human Cyp11a1 In Complex With | 2e-07 | ||
| 2q9f_A | 456 | Crystal Structure Of Human Cytochrome P450 46a1 In | 5e-07 | ||
| 2q9f_A | 456 | Crystal Structure Of Human Cytochrome P450 46a1 In | 7e-07 | ||
| 1ea1_A | 455 | Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) | 3e-06 | ||
| 2w0a_A | 455 | Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( | 4e-06 | ||
| 1x8v_A | 455 | Estriol-Bound And Ligand-Free Structures Of Sterol | 4e-06 | ||
| 1u13_A | 455 | Crystal Structure Analysis Of The C37lC151TC442A-Tr | 4e-06 | ||
| 3ruk_A | 494 | Human Cytochrome P450 Cyp17a1 In Complex With Abira | 4e-06 | ||
| 3mzs_A | 486 | Crystal Structure Of Cytochrome P450 Cyp11a1 In Com | 1e-05 | ||
| 4dvq_A | 483 | Structure Of Human Aldosterone Synthase, Cyp11b2, I | 4e-05 | ||
| 4dvq_A | 483 | Structure Of Human Aldosterone Synthase, Cyp11b2, I | 4e-05 | ||
| 4gqs_A | 477 | Structure Of Human Microsomal Cytochrome P450 (cyp) | 4e-05 | ||
| 4gqs_A | 477 | Structure Of Human Microsomal Cytochrome P450 (cyp) | 4e-05 | ||
| 2pg5_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 1e-04 | ||
| 2pg5_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 2e-04 | ||
| 2pg6_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 L240 | 2e-04 | ||
| 2pg6_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 L240 | 2e-04 | ||
| 1z10_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 With | 2e-04 | ||
| 1z10_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 With | 2e-04 | ||
| 3czh_A | 481 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 2e-04 | ||
| 3czh_A | 481 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 2e-04 | ||
| 3c6g_A | 479 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 2e-04 | ||
| 3c6g_A | 479 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 2e-04 | ||
| 2pg7_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 2e-04 | ||
| 2pg7_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 3e-04 |
| >pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 | Back alignment and structure |
|
| >pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 | Back alignment and structure |
| >pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 | Back alignment and structure |
| >pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 | Back alignment and structure |
| >pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 | Back alignment and structure |
| >pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 | Back alignment and structure |
| >pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 | Back alignment and structure |
| >pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 | Back alignment and structure |
| >pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 | Back alignment and structure |
| >pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 | Back alignment and structure |
| >pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 | Back alignment and structure |
| >pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 | Back alignment and structure |
| >pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 | Back alignment and structure |
| >pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 | Back alignment and structure |
| >pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 | Back alignment and structure |
| >pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 | Back alignment and structure |
| >pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 | Back alignment and structure |
| >pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 | Back alignment and structure |
| >pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 | Back alignment and structure |
| >pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 | Back alignment and structure |
| >pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 | Back alignment and structure |
| >pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 | Back alignment and structure |
| >pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 | Back alignment and structure |
| >pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 | Back alignment and structure |
| >pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 | Back alignment and structure |
| >pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 | Back alignment and structure |
| >pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 | Back alignment and structure |
| >pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 | Back alignment and structure |
| >pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 | Back alignment and structure |
| >pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 | Back alignment and structure |
| >pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 | Back alignment and structure |
| >pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 | Back alignment and structure |
| >pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 | Back alignment and structure |
| >pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 | Back alignment and structure |
| >pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 | Back alignment and structure |
| >pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 | Back alignment and structure |
| >pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 | Back alignment and structure |
| >pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 | Back alignment and structure |
| >pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 | Back alignment and structure |
| >pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 | Back alignment and structure |
| >pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 | Back alignment and structure |
| >pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 | Back alignment and structure |
| >pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 | Back alignment and structure |
| >pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 | Back alignment and structure |
| >pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 | Back alignment and structure |
| >pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 | Back alignment and structure |
| >pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 | Back alignment and structure |
| >pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 | Back alignment and structure |
| >pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 | Back alignment and structure |
| >pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 | Back alignment and structure |
| >pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 | Back alignment and structure |
| >pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 | Back alignment and structure |
| >pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 | Back alignment and structure |
| >pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 | Back alignment and structure |
| >pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 | Back alignment and structure |
| >pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 | Back alignment and structure |
| >pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 482 | |||
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 3e-97 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 3e-89 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 8e-63 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 1e-61 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 2e-62 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 1e-61 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 9e-61 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 7e-60 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 1e-59 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 2e-57 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 2e-59 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 2e-56 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 9e-59 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 3e-56 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 9e-54 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 1e-53 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 1e-52 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 1e-50 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 2e-52 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 2e-49 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 2e-52 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 3e-52 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 7e-52 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 1e-49 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 3e-48 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 1e-45 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 2e-47 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 5e-47 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 3e-46 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 4e-42 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 9e-41 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 2e-40 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 1e-39 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 3e-39 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 2e-36 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 3e-35 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 5e-32 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 4e-30 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 1e-22 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 1e-21 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 3e-22 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 4e-22 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 9e-22 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 2e-21 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 1e-20 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 2e-20 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 5e-20 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 8e-20 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 2e-19 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 4e-19 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 2e-17 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 6e-17 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 3e-17 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 1e-16 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 1e-16 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 4e-16 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 3e-16 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 9e-16 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 5e-14 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 5e-14 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 5e-14 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 5e-14 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 6e-14 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 9e-14 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 7e-14 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 1e-13 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 7e-14 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 7e-14 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 3e-13 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 3e-13 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 7e-13 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 7e-13 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 8e-13 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 9e-13 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 9e-13 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 9e-13 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 9e-13 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 9e-13 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 1e-12 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 1e-12 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 1e-12 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 1e-12 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 1e-12 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 1e-12 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 1e-12 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 3e-12 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 1e-12 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 1e-12 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 2e-12 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 2e-12 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 2e-12 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 2e-12 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 2e-12 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 2e-12 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 2e-12 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 4e-12 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 3e-12 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 3e-12 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 3e-12 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 6e-12 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 3e-12 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 3e-12 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 4e-12 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 4e-12 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 5e-12 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 5e-12 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 7e-12 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 1e-11 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 7e-12 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 7e-12 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 1e-11 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 1e-11 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 1e-11 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 1e-11 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 2e-11 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 2e-11 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 2e-11 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 4e-11 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 3e-11 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 6e-11 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 3e-11 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 3e-11 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 3e-11 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 3e-11 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 3e-11 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 3e-11 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 3e-11 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 4e-11 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 4e-11 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 8e-11 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 4e-11 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 7e-11 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 4e-11 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 4e-11 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 4e-11 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 1e-10 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 5e-11 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 1e-10 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 6e-11 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 9e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 2e-10 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 4e-10 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 3e-10 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 3e-10 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 2e-09 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 3e-09 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 7e-09 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 7e-09 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 2e-08 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 3e-08 |
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
Score = 300 bits (771), Expect = 3e-97
Identities = 84/248 (33%), Positives = 132/248 (53%), Gaps = 23/248 (9%)
Query: 13 VILFMIIVFIPMFARFIPLSLFNSRVMEYLVALSKKVAHMR-KTEGVRRNDFLQLMVEHQ 71
+ + F+ + + +F V +L K++ R + R DFLQLM++ Q
Sbjct: 198 FLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQ 257
Query: 72 DDSNAPSDDVIKVKTVTVGENGETKQKVFLSEDTVTAQSILFLIAGYETSSTLLMFASYQ 131
+ + ET+ LS+ + AQSI+F+ AGYET+S++L F Y+
Sbjct: 258 N-------------------SKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYE 298
Query: 132 LSLNVDIQDKLRAHVNEILDKHGGKCTYEALQDMSYLEMVLNETLRMHPSVARVDRHCTL 191
L+ + D+Q KL+ ++ +L + TY+ + M YL+MV+NETLR+ P R++R C
Sbjct: 299 LATHPDVQQKLQEEIDAVL-PNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKK 357
Query: 192 DYTLPDTNIVIRAGESVNVPIMGLHYDPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFGA 251
D + + I G V +P LH DPKY+ +P KF P+RF + K PY++ PFG+
Sbjct: 358 DVEING--MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGS 415
Query: 252 GPRNCIGN 259
GPRNCIG
Sbjct: 416 GPRNCIGM 423
|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 100.0 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 100.0 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 100.0 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 100.0 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 100.0 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 100.0 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 100.0 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 100.0 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 100.0 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 100.0 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 100.0 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 100.0 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 100.0 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 100.0 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 100.0 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 100.0 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 100.0 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 100.0 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 100.0 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 100.0 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 100.0 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 100.0 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 100.0 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 100.0 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 100.0 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 100.0 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 100.0 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 100.0 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 100.0 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 100.0 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 100.0 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 100.0 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 100.0 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 100.0 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 100.0 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 100.0 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 100.0 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 100.0 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 100.0 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 100.0 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 100.0 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 100.0 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 100.0 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 100.0 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 100.0 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 100.0 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 100.0 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 100.0 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 100.0 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 100.0 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 100.0 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 100.0 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 100.0 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 100.0 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 100.0 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 100.0 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 100.0 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 100.0 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 100.0 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 100.0 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 100.0 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 100.0 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 100.0 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 100.0 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 100.0 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 100.0 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 100.0 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 100.0 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 100.0 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 100.0 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 100.0 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 100.0 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 100.0 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 100.0 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 100.0 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 100.0 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 100.0 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 100.0 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 100.0 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 100.0 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 100.0 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 100.0 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 100.0 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 100.0 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 100.0 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 100.0 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 100.0 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 100.0 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 100.0 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 100.0 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 100.0 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 100.0 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 100.0 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 100.0 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 100.0 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 99.98 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 99.98 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 99.98 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 99.98 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 99.98 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 99.98 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 99.98 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 99.98 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 99.98 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 99.98 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 99.98 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 99.98 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 99.98 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 99.98 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 99.98 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 99.98 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 99.97 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.97 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 99.97 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 99.97 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 99.97 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 99.97 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 99.97 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 99.97 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 99.97 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 99.97 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 99.97 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 99.97 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 99.97 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 99.97 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 99.97 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 99.97 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 99.97 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 99.97 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 99.97 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 99.97 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 99.97 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 99.97 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 99.97 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 99.97 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.97 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 99.97 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 99.97 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 99.97 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 99.96 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 99.96 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 99.96 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 99.96 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 99.95 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 99.94 |
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=9.9e-41 Score=339.80 Aligned_cols=205 Identities=24% Similarity=0.385 Sum_probs=179.7
Q ss_pred hHHHHHHHHHHHhhhcCCCCCCchhhhhhhhccCCCCccccCCCCHHHHHHHHHHHHHhchHHHHHHHHHHHHHHhcChH
Q psy1708 270 NKRNDFLQLMVEHQDDSNAPSDDVIKVKTVTVGENGETKQKVFLSEDTVTAQSILFLIAGYETSSTLLMFASYQLSLNVD 349 (482)
Q Consensus 270 ~~~~~~~~~~~~~~~~~~~~~~d~i~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~~~~l~~~p~ 349 (482)
..+.+++..+++++.......+|+++.++....+++ ..++++++..++..+++||+|||+.+++|++++|+.||+
T Consensus 210 ~~l~~~~~~~i~~r~~~~~~~~d~l~~ll~~~~~~~-----~~ls~~ei~~~~~~~~~aG~dTt~~~l~~~l~~L~~~P~ 284 (461)
T 3ld6_A 210 REIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDG-----RPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKT 284 (461)
T ss_dssp HHHHHHHHHHHHHHTTCCCCCCSHHHHHHTCBCTTS-----CBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHH
T ss_pred HHHHHHHHHHHHHHHhcCCCCcchhhhhHHhhhccc-----CCCCHHHHHHHHHhhhhcccccccccchhhhcccccChH
Confidence 344555555555555555566788887655433332 249999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhhcCCCCChhhhhcchHHHHHHHHhhhcCCCccccccccccceeecCCceEeCCCCEEEEccccccc
Q psy1708 350 IQDKLRAHVNEILDKHGGKCTYEALQDMSYLEMVLNETLRMHPSVARVDRHCTLDYTLPDTNIVIRAGESVNVPIMGLHY 429 (482)
Q Consensus 350 ~~~~l~~Ei~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~~l~~~~~~ip~g~~v~~~~~~~~~ 429 (482)
+|+++++|++++++......+.+++.++||++|||+|+||++|+++...|.+++|+++. |+.||+|+.|+++.+++|+
T Consensus 285 ~q~kl~~Ei~~v~~~~~~~~~~~~l~~lpyl~avi~E~lRl~p~~~~~~r~~~~d~~~~--g~~ip~Gt~v~~~~~~~~~ 362 (461)
T 3ld6_A 285 LQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVA--GYTIPPGHQVCVSPTVNQR 362 (461)
T ss_dssp HHHHHHHHHHHHHCTTCCCCCHHHHHTCHHHHHHHHHHHHHSCSCCCEEEEESSCEEET--TEEECTTCEEEECHHHHTT
T ss_pred HHHHHHHHHHHHhcccccchhHHHHHHHhhhhheeeeccccCCchhccccccccceeeC--CcccCCCCeeeechHhhcC
Confidence 99999999999998877788999999999999999999999999999999999999995 8999999999999999999
Q ss_pred CCCCCCCCCCCCCCCCCCCcCCCCCCcccccccCCcccccchhhHHHHhhhc
Q psy1708 430 DPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFGAGPRNCIGFKILVRRYICI 481 (482)
Q Consensus 430 d~~~~~~p~~F~P~Rfl~~~~~~~~~~~~~~FG~G~r~C~G~~~a~~~~~~~ 481 (482)
||++|+||++|+||||+++++....+.+|+|||+|+|+|||++||.+|++++
T Consensus 363 d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~r~C~G~~lA~~e~~~~ 414 (461)
T 3ld6_A 363 LKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTI 414 (461)
T ss_dssp CTTTCTTTTSCCGGGGGSCCHHHHSSSSSCTTCCGGGCCSCHHHHHHHHHHH
T ss_pred CccccCCccccCccccCCCCcccCCCCccccCCCcCcCChhHHHHHHHHHHH
Confidence 9999999999999999987765556678999999999999999999998865
|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 482 | ||||
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 4e-31 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 4e-30 | |
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 1e-30 | |
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 7e-30 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 1e-27 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 1e-26 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 9e-23 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 9e-23 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 3e-20 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 1e-19 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 1e-13 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 1e-12 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 6e-13 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 6e-13 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 9e-13 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 9e-13 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 2e-12 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 2e-12 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 2e-12 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 2e-12 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 5e-12 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 6e-12 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 9e-12 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 9e-12 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 5e-11 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 5e-11 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 7e-11 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 7e-11 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 1e-10 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 1e-10 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 9e-10 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 9e-10 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 1e-09 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 1e-09 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 3e-09 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 3e-09 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 1e-08 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 1e-08 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 6e-08 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 6e-08 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 6e-08 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 6e-08 |
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome p450 2b4 species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Score = 123 bits (308), Expect = 4e-31
Identities = 55/320 (17%), Positives = 109/320 (34%), Gaps = 6/320 (1%)
Query: 156 KCTYEALQDMSYLEMVLNETLRMHPSVARVDRHCTLDYTLPDTNIVIR-AGESVNVPIMG 214
+ + ++D + + E ++ + + L +T + + + G
Sbjct: 99 RFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFG 158
Query: 215 LHYDPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFGAGPRNCIGNTTWIFSEMSENKRND 274
+D K D + S VF F ++ G I+ + E N
Sbjct: 159 KRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLKHFPGTHRQIYRNLQE--INT 216
Query: 275 FLQLMVEHQDDSNAPSDDVIKVKTVTVGENGETKQKVF-LSEDTVTAQSILFLIAGYETS 333
F+ VE + PS+ + + + + + AG ET+
Sbjct: 217 FIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGTETT 276
Query: 334 STLLMFASYQLSLNVDIQDKLRAHVNEILDKHGGKCTYEALQDMSYLEMVLNETLRMHPS 393
ST L + + + ++++ + +++ + M Y + V++E R+
Sbjct: 277 STTLRYGFLLMLKYPHVTERVQKEIEQVI-GSHRPPALDDRAKMPYTDAVIHEIQRLGDL 335
Query: 394 VARVDRHCTLDYTLPDTNIVIRAGESVNVPIMGLHYDPKYYPDPYKFDPDRFLPEEKAKR 453
+ H T VI V + +DP+Y+ P F+P FL A +
Sbjct: 336 IPFGVPHTVTKDTQFR-GYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALK 394
Query: 454 SPYVFLPFGAGPRNCIGFKI 473
F+PF G R C+G I
Sbjct: 395 RNEGFMPFSLGKRICLGEGI 414
|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 100.0 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 100.0 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 100.0 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 100.0 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 100.0 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 100.0 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 100.0 | |
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 100.0 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 100.0 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 100.0 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 100.0 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 100.0 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 100.0 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 99.98 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 99.97 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 99.97 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 99.96 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 99.96 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 99.96 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 99.96 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 99.95 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 99.95 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 99.95 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 99.95 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 99.95 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 99.95 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 99.95 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 99.94 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 99.94 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 99.94 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 99.94 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 99.94 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 99.94 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 99.94 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 99.94 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 99.93 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 99.92 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 99.92 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.92 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 99.91 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 99.91 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.89 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.3e-38 Score=317.65 Aligned_cols=170 Identities=40% Similarity=0.755 Sum_probs=157.9
Q ss_pred ccCCCCHHHHHHHHHHHHHhchHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHHhhcCCCCChhhhhcchHHHHHHHHhh
Q psy1708 309 QKVFLSEDTVTAQSILFLIAGYETSSTLLMFASYQLSLNVDIQDKLRAHVNEILDKHGGKCTYEALQDMSYLEMVLNETL 388 (482)
Q Consensus 309 ~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~~~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~~~~~l~a~i~E~l 388 (482)
...++++++++..++.+++||++||+.+++|++++|++||++|+++++|++++++. ...++.+++.++||++||++|++
T Consensus 259 ~~~~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~-~~~~~~~~l~~~~~l~a~i~E~l 337 (472)
T d1tqna_ 259 SHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN-KAPPTYDTVLQMEYLDMVVNETL 337 (472)
T ss_dssp CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTT-TCCCCHHHHHHCHHHHHHHHHHH
T ss_pred cccchhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccc-cccchHHHhhccccccceeeecc
Confidence 34469999999999999999999999999999999999999999999999999865 44567888999999999999999
Q ss_pred hcCCCccccccccccceeecCCceEeCCCCEEEEcccccccCCCCCCCCCCCCCCCCCCCcCCCCCCcccccccCCcccc
Q psy1708 389 RMHPSVARVDRHCTLDYTLPDTNIVIRAGESVNVPIMGLHYDPKYYPDPYKFDPDRFLPEEKAKRSPYVFLPFGAGPRNC 468 (482)
Q Consensus 389 Rl~p~~~~~~r~~~~d~~l~~~~~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~Rfl~~~~~~~~~~~~~~FG~G~r~C 468 (482)
|++|+++.+.|.+.+|+.+. |+.|||||.|+++.+++|+||++|+||++|+||||++.+.....+..|+|||+|+|+|
T Consensus 338 Rl~p~~~~~~r~~~~d~~~~--g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C 415 (472)
T d1tqna_ 338 RLFPIAMRLERVCKKDVEIN--GMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNC 415 (472)
T ss_dssp HHCCTTCCEEEECCSCEEET--TEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSC
T ss_pred ccCCcccccccccccCcccc--CceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCceecCCCCCCccC
Confidence 99999999999999999885 8999999999999999999999999999999999998877666778899999999999
Q ss_pred cchhhHHHHhhhc
Q psy1708 469 IGFKILVRRYICI 481 (482)
Q Consensus 469 ~G~~~a~~~~~~~ 481 (482)
||+++|.++++++
T Consensus 416 ~G~~~A~~~~~~~ 428 (472)
T d1tqna_ 416 IGMRFALMNMKLA 428 (472)
T ss_dssp TTHHHHHHHHHHH
T ss_pred hhHHHHHHHHHHH
Confidence 9999999998865
|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|