Diaphorina citri psyllid: psy17102

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--

EARRKKKEEEEEEEEEKQEEEGEEKKDGPTTPKLSLWFSHLPNCRFLTTVHRYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEARELGLIYTSGAPLPPGSANPSSPGGQDNNNGALNLQGNRVGGEQNHSYPDSPSGNRSPDEKKIKINVDEDSEDSLDDNMNAEHRTRTSTNNNNTTMPKSSRTPSPNQLVDPTGEVTKSPAPVPSPRIQEESSDESETVLPENLSLPKNTPMSADSTSPMSAEHAYLYTHPYSPYQNGRSPVDVLRRVFPNRRRGEVETVLQRCKGDVLQAIEMMVYSEQLEEPRSAFSPLVSAFQRNFASQQANRRFLTAPYSGTGYLPTIMRPQSEYPTLPLQPPGGVPDLYSGNTAYRIESALSE

ccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

****************************************************YQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAA**************************************************************************EKKIKINVD************************************************************************************************************GRSPVDVLRRVFPNRRRGEVETVLQRCKGDVLQAIEMMVYSEQ**********LVSAFQRNFA***ANRRFLTAPYSGTGYLPTIMRPQ*********************TAY********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxGPTTPKLSLWFSHLPNCRFLTTVHRYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEARELGLIYTSGAPLPPGSANPSSPGGQDNNNGALNLQGNRVGGEQNHSYPDSPSGNRSPDEKKIKINVDEDSEDSLDDNMNAEHRTRTSTNNNNTTMPKSSRTPSPNQLVDPTGEVTKSPAPVPSPRIQEESSDESETVLPENLSLPKNTPMSADSTSPMSAEHAYLYTHPYSPYQNGRSPVDVLRRVFPNRRRGEVETVLQRCKGDVLQAIEMMVYSEQLEEPRSAFSPLVSAFQRNFASQQANRRFLTAPYSGTGYLPTIMRPQSEYPTLPLQPPGGVPDLYSGNTAYRIESALSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Doublesex- and mab-3-related transcription factor A2	May be involved in sexual development.	confident	Q5UU75

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007548 [BP]	sex differentiation	probable	GO:0032502, GO:0003006, GO:0008150, GO:0000003, GO:0022414
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LPV, chain A
Confidence level:very confident
Coverage over the Query: 55-101
View the alignment between query and template
View the model in PyMOL

Template: 1WGL, chain A
Confidence level:probable
Coverage over the Query: 291-334
View the alignment between query and template
View the model in PyMOL