Diaphorina citri psyllid: psy17126


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MAAKALRLPPMPSIRDIIKLYKLRALKQLSQNFLFEPRLTDKIVRNAGTITGNEVCEVGPGPGSITRSILNRRPARLVLIEKDPRFTPCLDMLAQASPCPVHFHLGDVMSFTMQNMFSEDRRRDWSEGLPGIRIIGNLPFNVSTPLIIKWIQAISENLLFPKHKRQLVVSLLERACVKPILRPYQLSVQEFGQICLAYRDMCEEMPGLYEYTLEDTPGDIEPEAVAEQEGEGDEIDFNKL
ccccccccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccEEEEEcccccHHHHHHHHcccccEEEEEEccccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHHHHHccccccEEEEEHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccEEEEECccccccccccccccccccccccccc
******R**PMPSIRDIIKLYKLRALKQLSQNFLFEPRLTDKIVRNAGTITGNEVCEVGPGPGSITRSILNRRPARLVLIEKDPRFTPCLDMLAQASPCPVHFHLGDVMSFTMQNMFSEDRRRDWSEGLPGIRIIGNLPFNVSTPLIIKWIQAISENLLFPKHKRQLVVSLLERACVKPILRPYQLSVQEFGQICLAYRDMCEEMPGLYEYTLEDTPGDIEP*****************L
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKALRLPPMPSIRDIIKLYKLRALKQLSQNFLFEPRLTDKIVRNAGTITGNEVCEVGPGPGSITRSILNRRPARLVLIEKDPRFTPCLDMLAQASPCPVHFHLGDVMSFTMQNMFSEDRRRDWSEGLPGIRIIGNLPFNVSTPLIIKWIQAISENLLFPKHKRQLVVSLLERACVKPILRPYQLSVQEFGQICLAYRDMCEEMPGLYEYTLEDTPGDIEPEAVAEQEGEGDEIDFNKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dimethyladenosine transferase 1, mitochondrial S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity.confidentQ5R4V9
Dimethyladenosine transferase 1, mitochondrial S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity.confidentQ8JZM0
Dimethyladenosine transferase 1, mitochondrial S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA. Stimulates transcription independently of the methyltransferase activity.confidentQ28HM1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003674 [MF]molecular_functionprobable
GO:0042645 [CC]mitochondrial nucleoidprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FUT, chain A
Confidence level:very confident
Coverage over the Query: 9-117,130-199
View the alignment between query and template
View the model in PyMOL