Diaphorina citri psyllid: psy17133


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ
ccccccCEEEEEccccccEEEEEEccccEEEEEcccccEEEEEccccccccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEECcc
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Striatin-3 Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.confidentA5D7H2
Striatin-3 Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.confidentP58405
Striatin-3 Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.confidentQ9ERG2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0000159 [CC]protein phosphatase type 2A complexprobableGO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0032355 [BP]response to estradiol stimulusprobableGO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0014070, GO:0009725, GO:0043627, GO:0042221, GO:0097305, GO:0010033, GO:0048545
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0070016 [MF]armadillo repeat domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0072686 [CC]mitotic spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051721 [MF]protein phosphatase 2A bindingprobableGO:0019899, GO:0019903, GO:0019902, GO:0003674, GO:0005488, GO:0005515
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0048666 [BP]neuron developmentprobableGO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YNN, chain A
Confidence level:very confident
Coverage over the Query: 3-116
View the alignment between query and template
View the model in PyMOL