Psyllid ID: psy17133


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ
ccccccEEEEEEccccccEEEEEEccccEEEEEcccccEEEEEccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEEcc
ccccccccEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEcccccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEEccccEEEEEEccccEEEEEcccc
mfyngtptsidfvrdESTKMVTAFDnsacvlfdletgkpvvridssqfgvsgggginrvvchptlpltitahddrhirffdnvSGKLVHSMVAHLDAvtslavdpqglyilsgtyq
mfyngtptsidfvrdESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVtslavdpqglYILSGTYQ
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ
**********DFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILS****
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTY*
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ
*FYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
Q9ERG2796 Striatin-3 OS=Mus musculu yes N/A 0.965 0.140 0.566 2e-34
Q13033797 Striatin-3 OS=Homo sapien yes N/A 0.956 0.139 0.587 3e-34
A5D7H2797 Striatin-3 OS=Bos taurus yes N/A 0.956 0.139 0.578 3e-34
P58405794 Striatin-3 OS=Rattus norv yes N/A 0.965 0.141 0.557 3e-34
P70483780 Striatin OS=Rattus norveg no N/A 0.956 0.142 0.508 6e-30
O43815780 Striatin OS=Homo sapiens no N/A 0.956 0.142 0.5 1e-29
O55106780 Striatin OS=Mus musculus no N/A 0.956 0.142 0.517 2e-29
P58404760 Striatin-4 OS=Mus musculu no N/A 0.948 0.144 0.544 2e-29
Q9NRL3753 Striatin-4 OS=Homo sapien no N/A 0.948 0.146 0.535 2e-28
Q54J37827 Striatin homolog OS=Dicty yes N/A 0.913 0.128 0.378 7e-16
>sp|Q9ERG2|STRN3_MOUSE Striatin-3 OS=Mus musculus GN=Strn3 PE=1 SV=1 Back     alignment and function desciption
 Score =  144 bits (362), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/113 (56%), Positives = 88/113 (77%), Gaps = 1/113 (0%)

Query: 4   NGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSS-QFGVSGGGGINRVVCH 62
           +G PTS+DF+  +   MVT+F+  + V++DLET + +V + S    G+     INRVV H
Sbjct: 630 HGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVMLSSQVDSGLQSSNHINRVVSH 689

Query: 63  PTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTY 115
           PTLP+TITAH+DRHI+FFDN +GK++HSMVAHLDAVTSLAVDP G+Y++SG++
Sbjct: 690 PTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSH 742




Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.
Mus musculus (taxid: 10090)
>sp|Q13033|STRN3_HUMAN Striatin-3 OS=Homo sapiens GN=STRN3 PE=1 SV=3 Back     alignment and function description
>sp|A5D7H2|STRN3_BOVIN Striatin-3 OS=Bos taurus GN=STRN3 PE=2 SV=1 Back     alignment and function description
>sp|P58405|STRN3_RAT Striatin-3 OS=Rattus norvegicus GN=Strn3 PE=2 SV=2 Back     alignment and function description
>sp|P70483|STRN_RAT Striatin OS=Rattus norvegicus GN=Strn PE=1 SV=1 Back     alignment and function description
>sp|O43815|STRN_HUMAN Striatin OS=Homo sapiens GN=STRN PE=1 SV=4 Back     alignment and function description
>sp|O55106|STRN_MOUSE Striatin OS=Mus musculus GN=Strn PE=1 SV=2 Back     alignment and function description
>sp|P58404|STRN4_MOUSE Striatin-4 OS=Mus musculus GN=Strn4 PE=1 SV=2 Back     alignment and function description
>sp|Q9NRL3|STRN4_HUMAN Striatin-4 OS=Homo sapiens GN=STRN4 PE=1 SV=2 Back     alignment and function description
>sp|Q54J37|STRN_DICDI Striatin homolog OS=Dictyostelium discoideum GN=strn PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
242010921 733 Striatin, putative [Pediculus humanus co 0.948 0.150 0.696 6e-41
321475277 684 hypothetical protein DAPPUDRAFT_208467 [ 0.956 0.162 0.652 3e-38
270005502 655 hypothetical protein TcasGA2_TC007565 [T 0.965 0.170 0.637 5e-38
189236270 650 PREDICTED: similar to AGAP008755-PA [Tri 0.965 0.172 0.628 2e-37
260787992 725 hypothetical protein BRAFLDRAFT_124920 [ 0.965 0.154 0.646 5e-37
241676656 711 striatin, putative [Ixodes scapularis] g 0.965 0.157 0.646 8e-37
427779383 842 Putative cell-cycle nuclear protein [Rhi 0.965 0.133 0.640 1e-35
170033214 648 striatin [Culex quinquefasciatus] gi|167 0.948 0.169 0.610 4e-35
350410641 721 PREDICTED: striatin-3-like isoform 2 [Bo 0.913 0.147 0.616 6e-35
350410638 705 PREDICTED: striatin-3-like isoform 1 [Bo 0.913 0.150 0.616 7e-35
>gi|242010921|ref|XP_002426206.1| Striatin, putative [Pediculus humanus corporis] gi|212510257|gb|EEB13468.1| Striatin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 78/112 (69%), Positives = 97/112 (86%), Gaps = 2/112 (1%)

Query: 4   NGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHP 63
           +G+PTS+DFVRDE+  +VTAF +S CV+FD ETGKPVVR +++Q  +     INRVVCHP
Sbjct: 570 DGSPTSVDFVRDEANHIVTAFSSSNCVIFDCETGKPVVRFENNQVRIKRL--INRVVCHP 627

Query: 64  TLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTY 115
           +LPLTITAH+DRHIRF+DN SGKLVHSMVAHLDAV+SLAVDP GL++LSG++
Sbjct: 628 SLPLTITAHEDRHIRFYDNNSGKLVHSMVAHLDAVSSLAVDPNGLFLLSGSH 679




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321475277|gb|EFX86240.1| hypothetical protein DAPPUDRAFT_208467 [Daphnia pulex] Back     alignment and taxonomy information
>gi|270005502|gb|EFA01950.1| hypothetical protein TcasGA2_TC007565 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189236270|ref|XP_001814737.1| PREDICTED: similar to AGAP008755-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|260787992|ref|XP_002589035.1| hypothetical protein BRAFLDRAFT_124920 [Branchiostoma floridae] gi|229274208|gb|EEN45046.1| hypothetical protein BRAFLDRAFT_124920 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|241676656|ref|XP_002412565.1| striatin, putative [Ixodes scapularis] gi|215506367|gb|EEC15861.1| striatin, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|427779383|gb|JAA55143.1| Putative cell-cycle nuclear protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|170033214|ref|XP_001844473.1| striatin [Culex quinquefasciatus] gi|167873880|gb|EDS37263.1| striatin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|350410641|ref|XP_003489100.1| PREDICTED: striatin-3-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350410638|ref|XP_003489099.1| PREDICTED: striatin-3-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
FB|FBgn0044323730 Cka "Connector of kinase to AP 0.948 0.150 0.610 1.8e-32
MGI|MGI:2151064796 Strn3 "striatin, calmodulin bi 0.965 0.140 0.566 2.1e-31
RGD|621827794 Strn3 "striatin, calmodulin bi 0.965 0.141 0.557 2.7e-31
UNIPROTKB|A5D7H2797 STRN3 "Striatin-3" [Bos taurus 0.965 0.140 0.566 2.8e-31
UNIPROTKB|F1NH54811 STRN3 "Uncharacterized protein 0.965 0.138 0.566 2.9e-31
UNIPROTKB|Q13033797 STRN3 "Striatin-3" [Homo sapie 0.965 0.140 0.566 3.5e-31
ZFIN|ZDB-GENE-070112-1172782 zgc:158357 "zgc:158357" [Danio 0.956 0.141 0.535 1.6e-27
UNIPROTKB|E1C837800 STRN "Uncharacterized protein" 0.956 0.138 0.526 2.7e-27
MGI|MGI:1333757780 Strn "striatin, calmodulin bin 0.956 0.142 0.517 4.2e-27
UNIPROTKB|E1BFB3780 STRN "Uncharacterized protein" 0.956 0.142 0.5 8.8e-27
FB|FBgn0044323 Cka "Connector of kinase to AP-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 1.8e-32, P = 1.8e-32
 Identities = 69/113 (61%), Positives = 93/113 (82%)

Query:     5 GTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGG--INRVVCH 62
             G P+S+DFVR+E   +V A++++ C+++D ETGK VVR++++Q  +SG  G  IN+VV H
Sbjct:   565 GVPSSVDFVRNEVDHIVVAYNSAHCIVYDTETGKQVVRLEAAQ-EMSGNTGKFINKVVSH 623

Query:    63 PTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTY 115
             PTLP+TITAH+DRHIRF+DN SG LVHSMVAHL+ VTSLAVD  GLY+LSG++
Sbjct:   624 PTLPITITAHEDRHIRFWDNTSGTLVHSMVAHLEPVTSLAVDAHGLYLLSGSH 676




GO:0007254 "JNK cascade" evidence=NAS;TAS
GO:0007391 "dorsal closure" evidence=IMP;NAS;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0046330 "positive regulation of JNK cascade" evidence=IGI;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0042051 "compound eye photoreceptor development" evidence=IMP
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0072686 "mitotic spindle" evidence=IDA
MGI|MGI:2151064 Strn3 "striatin, calmodulin binding protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621827 Strn3 "striatin, calmodulin binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7H2 STRN3 "Striatin-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH54 STRN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q13033 STRN3 "Striatin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-1172 zgc:158357 "zgc:158357" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C837 STRN "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1333757 Strn "striatin, calmodulin binding protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFB3 STRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q13033STRN3_HUMANNo assigned EC number0.58770.95680.1392yesN/A
Q9ERG2STRN3_MOUSENo assigned EC number0.56630.96550.1407yesN/A
A5D7H2STRN3_BOVINNo assigned EC number0.57890.95680.1392yesN/A
P58405STRN3_RATNo assigned EC number0.55750.96550.1410yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 6e-11
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-08
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 2e-06
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 7e-05
smart0032040 smart00320, WD40, WD40 repeats 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 57.3 bits (139), Expect = 6e-11
 Identities = 26/108 (24%), Positives = 47/108 (43%), Gaps = 7/108 (6%)

Query: 8   TSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPL 67
             +    D  T + +   +    L+DLETG+ V  +      VS       V   P   +
Sbjct: 55  RDVAASAD-GTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSS------VAFSPDGRI 107

Query: 68  TITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTY 115
             ++  D+ I+ +D  +GK + ++  H D V S+A  P G ++ S + 
Sbjct: 108 LSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQ 155


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
KOG0263|consensus707 99.94
KOG0263|consensus 707 99.94
KOG0271|consensus 480 99.93
KOG0272|consensus459 99.93
KOG0271|consensus480 99.92
KOG0272|consensus459 99.92
KOG0266|consensus 456 99.92
KOG0284|consensus 464 99.91
PTZ00421 493 coronin; Provisional 99.91
KOG0286|consensus343 99.91
KOG0279|consensus 315 99.9
KOG0291|consensus 893 99.89
KOG0266|consensus 456 99.88
KOG0286|consensus343 99.88
KOG0273|consensus524 99.88
PTZ00420 568 coronin; Provisional 99.88
KOG0316|consensus 307 99.87
KOG0319|consensus 775 99.87
KOG0279|consensus 315 99.87
KOG0285|consensus 460 99.87
KOG0315|consensus311 99.86
PTZ00421 493 coronin; Provisional 99.85
KOG0645|consensus 312 99.85
KOG0302|consensus440 99.85
KOG1407|consensus313 99.85
KOG0276|consensus 794 99.85
KOG0295|consensus406 99.85
KOG0318|consensus 603 99.85
KOG0283|consensus 712 99.84
KOG0292|consensus 1202 99.84
KOG0319|consensus 775 99.84
KOG0303|consensus 472 99.84
KOG0285|consensus 460 99.84
KOG0645|consensus 312 99.84
KOG0973|consensus 942 99.83
KOG0295|consensus406 99.83
KOG0643|consensus 327 99.83
KOG0284|consensus 464 99.83
KOG0275|consensus 508 99.82
PTZ00420 568 coronin; Provisional 99.82
KOG0283|consensus 712 99.82
KOG0273|consensus 524 99.81
KOG0282|consensus 503 99.81
KOG0289|consensus506 99.81
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.8
KOG0289|consensus506 99.8
KOG0269|consensus 839 99.8
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.8
KOG0278|consensus334 99.8
KOG0318|consensus 603 99.8
KOG0647|consensus 347 99.79
KOG0293|consensus 519 99.79
KOG0265|consensus 338 99.79
KOG0282|consensus 503 99.79
KOG0276|consensus 794 99.79
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.79
KOG0643|consensus 327 99.79
KOG0265|consensus 338 99.79
KOG0296|consensus 399 99.78
PLN00181 793 protein SPA1-RELATED; Provisional 99.78
KOG0275|consensus 508 99.77
KOG0292|consensus 1202 99.77
KOG0264|consensus422 99.77
KOG1539|consensus 910 99.77
KOG1445|consensus 1012 99.77
KOG0264|consensus422 99.76
PLN00181 793 protein SPA1-RELATED; Provisional 99.76
KOG0294|consensus 362 99.76
KOG0291|consensus 893 99.76
KOG0281|consensus 499 99.76
KOG0277|consensus311 99.75
KOG1407|consensus313 99.75
KOG0296|consensus 399 99.75
KOG2394|consensus 636 99.75
KOG0294|consensus 362 99.75
KOG0641|consensus350 99.75
KOG1273|consensus 405 99.74
KOG0305|consensus484 99.74
KOG0772|consensus 641 99.74
KOG0305|consensus 484 99.74
KOG0973|consensus 942 99.74
KOG0267|consensus 825 99.74
KOG0277|consensus 311 99.74
KOG0315|consensus311 99.74
KOG0310|consensus 487 99.72
KOG0308|consensus 735 99.72
KOG2394|consensus 636 99.72
KOG0293|consensus519 99.71
KOG0306|consensus 888 99.71
KOG0288|consensus459 99.71
KOG0316|consensus 307 99.71
KOG1009|consensus 434 99.71
KOG0310|consensus 487 99.71
KOG0274|consensus 537 99.71
KOG0313|consensus423 99.71
KOG0639|consensus705 99.7
KOG0640|consensus 430 99.7
KOG1446|consensus311 99.7
KOG0281|consensus499 99.69
KOG0640|consensus 430 99.69
KOG0306|consensus 888 99.68
KOG1034|consensus 385 99.67
KOG0322|consensus323 99.67
KOG1274|consensus 933 99.66
KOG2110|consensus 391 99.66
KOG1408|consensus 1080 99.66
KOG0313|consensus423 99.65
KOG1446|consensus 311 99.65
KOG0308|consensus 735 99.65
KOG0303|consensus 472 99.64
KOG0299|consensus 479 99.63
KOG0267|consensus 825 99.63
KOG0270|consensus 463 99.63
KOG0772|consensus 641 99.63
KOG0299|consensus 479 99.62
KOG2096|consensus 420 99.62
KOG0639|consensus 705 99.61
KOG1007|consensus370 99.61
KOG0269|consensus 839 99.6
KOG0268|consensus 433 99.6
KOG1063|consensus 764 99.59
KOG1009|consensus 434 99.58
KOG0646|consensus 476 99.58
KOG2055|consensus514 99.57
KOG0771|consensus398 99.57
KOG1445|consensus 1012 99.57
KOG0300|consensus 481 99.57
KOG0278|consensus 334 99.56
KOG4283|consensus 397 99.56
KOG0647|consensus 347 99.56
KOG1539|consensus 910 99.56
KOG2048|consensus 691 99.55
KOG0646|consensus 476 99.55
KOG1036|consensus 323 99.55
KOG1273|consensus 405 99.54
KOG1538|consensus 1081 99.54
KOG1034|consensus 385 99.54
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.54
KOG0649|consensus 325 99.54
KOG0302|consensus440 99.54
KOG1332|consensus 299 99.53
KOG1007|consensus370 99.53
KOG2919|consensus406 99.53
KOG1310|consensus 758 99.53
KOG0301|consensus 745 99.53
KOG0641|consensus350 99.53
KOG0290|consensus364 99.52
KOG0268|consensus433 99.52
KOG1332|consensus 299 99.52
KOG1274|consensus 933 99.52
KOG4283|consensus 397 99.51
KOG0288|consensus 459 99.51
KOG1524|consensus 737 99.51
KOG1036|consensus323 99.51
KOG2111|consensus346 99.5
KOG0644|consensus 1113 99.49
KOG2096|consensus 420 99.49
KOG0274|consensus 537 99.49
KOG2048|consensus 691 99.49
KOG2139|consensus 445 99.48
KOG0771|consensus 398 99.48
KOG0301|consensus 745 99.48
KOG4328|consensus 498 99.47
KOG0307|consensus 1049 99.47
KOG2106|consensus 626 99.47
KOG0270|consensus 463 99.47
KOG2111|consensus346 99.46
KOG4227|consensus 609 99.44
KOG2055|consensus 514 99.43
KOG0650|consensus 733 99.43
KOG2445|consensus 361 99.41
KOG0300|consensus 481 99.41
KOG0321|consensus 720 99.41
KOG0290|consensus364 99.4
KOG3881|consensus 412 99.4
KOG4378|consensus 673 99.4
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.4
KOG4378|consensus 673 99.39
KOG1272|consensus 545 99.39
KOG2110|consensus 391 99.39
KOG1188|consensus 376 99.39
KOG1408|consensus 1080 99.38
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.38
KOG2106|consensus 626 99.37
KOG0642|consensus 577 99.37
KOG4547|consensus 541 99.36
KOG1963|consensus 792 99.35
KOG1272|consensus 545 99.35
PRK01742 429 tolB translocation protein TolB; Provisional 99.34
KOG0307|consensus 1049 99.33
KOG0974|consensus 967 99.33
COG2319 466 FOG: WD40 repeat [General function prediction only 99.33
KOG2919|consensus406 99.32
KOG4328|consensus498 99.31
KOG1523|consensus 361 99.31
KOG1523|consensus 361 99.31
KOG0322|consensus323 99.3
KOG1063|consensus 764 99.29
KOG2445|consensus361 99.27
KOG0642|consensus577 99.26
KOG2315|consensus 566 99.26
PRK05137 435 tolB translocation protein TolB; Provisional 99.26
KOG0321|consensus 720 99.25
KOG0974|consensus 967 99.25
PRK03629 429 tolB translocation protein TolB; Provisional 99.24
COG2319 466 FOG: WD40 repeat [General function prediction only 99.23
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.23
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.22
KOG2139|consensus 445 99.21
PRK02889 427 tolB translocation protein TolB; Provisional 99.21
KOG0649|consensus 325 99.2
PRK04922 433 tolB translocation protein TolB; Provisional 99.2
KOG1524|consensus 737 99.19
KOG3881|consensus412 99.18
PRK11028330 6-phosphogluconolactonase; Provisional 99.18
KOG0650|consensus733 99.18
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.17
KOG3914|consensus 390 99.17
KOG1587|consensus555 99.13
PRK03629429 tolB translocation protein TolB; Provisional 99.13
COG4946 668 Uncharacterized protein related to the periplasmic 99.11
COG4946 668 Uncharacterized protein related to the periplasmic 99.11
KOG4497|consensus 447 99.11
PRK00178 430 tolB translocation protein TolB; Provisional 99.1
PRK11028330 6-phosphogluconolactonase; Provisional 99.1
KOG1963|consensus 792 99.08
KOG1188|consensus 376 99.08
PRK04792 448 tolB translocation protein TolB; Provisional 99.06
PRK05137435 tolB translocation protein TolB; Provisional 99.05
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 99.05
PRK01742429 tolB translocation protein TolB; Provisional 99.0
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 99.0
KOG4227|consensus 609 99.0
KOG4547|consensus 541 98.99
PRK02889427 tolB translocation protein TolB; Provisional 98.99
KOG2321|consensus 703 98.99
PRK04922433 tolB translocation protein TolB; Provisional 98.98
KOG1310|consensus 758 98.98
KOG1587|consensus 555 98.98
KOG4497|consensus 447 98.96
KOG0280|consensus 339 98.96
PRK01029428 tolB translocation protein TolB; Provisional 98.96
KOG2695|consensus425 98.93
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.91
KOG0280|consensus339 98.89
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.88
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.88
KOG4640|consensus 665 98.87
PRK04792448 tolB translocation protein TolB; Provisional 98.84
KOG1517|consensus1387 98.82
KOG1240|consensus 1431 98.8
KOG1334|consensus 559 98.79
PRK01029428 tolB translocation protein TolB; Provisional 98.79
PRK04043 419 tolB translocation protein TolB; Provisional 98.79
PRK00178430 tolB translocation protein TolB; Provisional 98.79
KOG2315|consensus 566 98.78
KOG1538|consensus 1081 98.75
KOG1334|consensus 559 98.73
KOG2314|consensus 698 98.72
KOG1517|consensus1387 98.69
KOG0644|consensus 1113 98.65
KOG2321|consensus 703 98.63
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.62
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.61
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.6
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.57
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.54
KOG2695|consensus425 98.53
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.53
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.52
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 98.5
KOG2314|consensus 698 98.5
PRK04043419 tolB translocation protein TolB; Provisional 98.49
KOG2041|consensus 1189 98.45
KOG4532|consensus344 98.43
KOG3621|consensus 726 98.42
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.4
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.37
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.35
KOG4714|consensus319 98.34
KOG1645|consensus 463 98.34
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.33
KOG3617|consensus 1416 98.3
KOG3914|consensus 390 98.28
KOG1354|consensus 433 98.26
KOG1240|consensus 1431 98.25
KOG4532|consensus344 98.24
KOG1409|consensus 404 98.24
KOG1912|consensus 1062 98.22
KOG1064|consensus2439 98.2
KOG4714|consensus319 98.18
KOG2066|consensus 846 98.17
KOG1354|consensus433 98.15
KOG1064|consensus2439 98.12
KOG1409|consensus 404 98.12
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.1
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.06
KOG2041|consensus 1189 98.04
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.04
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.02
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.02
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.01
KOG0309|consensus 1081 98.01
KOG2066|consensus 846 97.98
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.97
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.96
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 97.96
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.95
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.93
KOG4190|consensus 1034 97.89
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.88
COG0823 425 TolB Periplasmic component of the Tol biopolymer t 97.86
KOG4649|consensus 354 97.86
PRK02888 635 nitrous-oxide reductase; Validated 97.84
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.83
KOG2079|consensus 1206 97.82
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.77
KOG1912|consensus 1062 97.7
KOG3621|consensus 726 97.68
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.67
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 97.67
PRK13616 591 lipoprotein LpqB; Provisional 97.67
KOG1832|consensus 1516 97.62
PRK02888 635 nitrous-oxide reductase; Validated 97.61
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.59
KOG1645|consensus 463 97.54
PF08450 246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.54
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 97.51
KOG3617|consensus 1416 97.5
KOG4499|consensus310 97.47
KOG1920|consensus 1265 97.39
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.37
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.34
KOG2444|consensus238 97.34
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.33
KOG1275|consensus 1118 97.32
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.32
KOG0882|consensus 558 97.3
KOG2395|consensus 644 97.3
KOG4190|consensus 1034 97.29
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.28
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.24
KOG2079|consensus 1206 97.24
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.19
KOG4640|consensus 665 97.17
KOG1832|consensus 1516 97.17
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.17
KOG1920|consensus 1265 97.12
KOG1275|consensus 1118 97.1
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.03
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.02
COG3391 381 Uncharacterized conserved protein [Function unknow 96.98
KOG4649|consensus 354 96.96
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 96.93
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.93
KOG2114|consensus 933 96.88
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.82
COG3391 381 Uncharacterized conserved protein [Function unknow 96.55
KOG2377|consensus 657 96.51
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.48
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.47
KOG2395|consensus 644 96.44
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.36
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 96.33
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.32
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.3
PRK13616591 lipoprotein LpqB; Provisional 96.29
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 96.23
PRK10115 686 protease 2; Provisional 96.07
KOG0309|consensus 1081 96.0
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.93
KOG2114|consensus 933 95.91
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.84
KOG1008|consensus 783 95.83
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 95.77
PF10647 253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.74
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.72
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 95.65
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.64
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 95.54
KOG3630|consensus 1405 95.5
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.48
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 95.41
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.38
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 95.32
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.12
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 95.09
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.05
KOG2247|consensus 615 95.05
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 94.98
KOG2444|consensus238 94.95
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.85
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.83
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 94.81
KOG0882|consensus 558 94.75
KOG4460|consensus 741 94.68
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.66
COG5167 776 VID27 Protein involved in vacuole import and degra 94.66
KOG2377|consensus 657 94.65
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 94.41
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.37
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.23
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 94.19
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 94.14
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.14
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 93.7
COG5167 776 VID27 Protein involved in vacuole import and degra 93.65
PF14761 215 HPS3_N: Hermansky-Pudlak syndrome 3 93.49
PRK10115 686 protease 2; Provisional 93.33
KOG1916|consensus 1283 93.3
KOG1008|consensus 783 93.29
PF13449326 Phytase-like: Esterase-like activity of phytase 93.22
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 92.96
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.93
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.74
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 92.63
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 92.56
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 92.36
KOG2280|consensus 829 92.31
COG4257 353 Vgb Streptogramin lyase [Defense mechanisms] 92.24
KOG1520|consensus 376 92.16
PRK13684334 Ycf48-like protein; Provisional 91.92
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.88
KOG4499|consensus310 91.85
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 91.63
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 91.17
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 90.86
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 90.56
PF07250 243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 90.42
KOG1897|consensus 1096 90.24
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 89.77
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 89.42
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 89.38
KOG1916|consensus 1283 89.3
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 89.17
PF05787524 DUF839: Bacterial protein of unknown function (DUF 89.0
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 88.78
KOG3616|consensus 1636 88.44
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 87.99
PHA02713 557 hypothetical protein; Provisional 87.64
PHA02713557 hypothetical protein; Provisional 87.25
PF03022 287 MRJP: Major royal jelly protein; InterPro: IPR0035 87.17
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 87.17
PF13449 326 Phytase-like: Esterase-like activity of phytase 87.12
KOG3630|consensus 1405 87.04
PF1234127 DUF3639: Protein of unknown function (DUF3639) ; I 87.03
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 86.71
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 86.53
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 85.73
PHA03098534 kelch-like protein; Provisional 85.09
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 84.92
KOG4441|consensus 571 83.78
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 83.43
PF12768 281 Rax2: Cortical protein marker for cell polarity 83.06
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 82.87
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 82.41
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 82.2
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 82.18
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 81.88
TIGR0260855 delta_60_rpt delta-60 repeat domain. This domain o 81.75
PLN00033398 photosystem II stability/assembly factor; Provisio 81.68
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 81.57
PF05096 264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 81.12
KOG3616|consensus 1636 81.03
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 80.74
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 80.12
>KOG0263|consensus Back     alignment and domain information
Probab=99.94  E-value=3.7e-26  Score=142.51  Aligned_cols=108  Identities=20%  Similarity=0.295  Sum_probs=103.5

Q ss_pred             CCCCCceEEEEccCCCcEEEEeeCCCeEEEEECCCCceeEEEecCCcCcCCCCceeEEEEcCCCCEEEEEeCCCeEEEEE
Q psy17133          2 FYNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFD   81 (116)
Q Consensus         2 ~~~~~v~~~~~~~~~~~~l~~~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~d~~i~~~~   81 (116)
                      .|.+-|.|+.|+| +.+++++|+.|.+|++||..+|..++.|.+|      .+.|.+++++|+|+++++|++|+.|.+||
T Consensus       533 ghlsDV~cv~FHP-Ns~Y~aTGSsD~tVRlWDv~~G~~VRiF~GH------~~~V~al~~Sp~Gr~LaSg~ed~~I~iWD  605 (707)
T KOG0263|consen  533 GHLSDVDCVSFHP-NSNYVATGSSDRTVRLWDVSTGNSVRIFTGH------KGPVTALAFSPCGRYLASGDEDGLIKIWD  605 (707)
T ss_pred             ccccccceEEECC-cccccccCCCCceEEEEEcCCCcEEEEecCC------CCceEEEEEcCCCceEeecccCCcEEEEE
Confidence            4778899999999 8999999999999999999999999999999      78999999999999999999999999999


Q ss_pred             CCCCeEEEEeecccccEEEEEECCCCcEEEeeecC
Q psy17133         82 NVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ  116 (116)
Q Consensus        82 ~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~s~d  116 (116)
                      +.+++.+..+.+|.+.+.++.|+++|..|++++.|
T Consensus       606 l~~~~~v~~l~~Ht~ti~SlsFS~dg~vLasgg~D  640 (707)
T KOG0263|consen  606 LANGSLVKQLKGHTGTIYSLSFSRDGNVLASGGAD  640 (707)
T ss_pred             cCCCcchhhhhcccCceeEEEEecCCCEEEecCCC
Confidence            99999999999999999999999999999999876



>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF12341 DUF3639: Protein of unknown function (DUF3639) ; InterPro: IPR022100 This domain family is found in eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>TIGR02608 delta_60_rpt delta-60 repeat domain Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
2yno_A 310 Yeast Betaprime Cop 1-304h6 Length = 310 3e-04
2ynn_A 304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 3e-04
3n0d_A 315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 4e-04
3psl_A 318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-04
2h9l_A 329 Wdr5delta23 Length = 329 5e-04
3n0e_A 315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-04
3mxx_A 315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 5e-04
2gnq_A 336 Structure Of Wdr5 Length = 336 5e-04
2h13_A 317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-04
2h9m_A 313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-04
3emh_A 318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-04
4a7j_A 318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-04
2g9a_A 311 Structural Basis For The Specific Recognition Of Me 5e-04
3smr_A 312 Crystal Structure Of Human Wd Repeat Domain 5 With 5e-04
2xl2_A 334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 5e-04
2g99_A 308 Structural Basis For The Specific Recognition Of Me 5e-04
2h68_A 312 Histone H3 Recognition And Presentation By The Wdr5 5e-04
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure

Iteration: 1

Score = 40.4 bits (93), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 33/105 (31%), Positives = 47/105 (44%), Gaps = 7/105 (6%) Query: 10 IDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTI 69 IDF E + T + + L++ ET V I ++ V G I R I Sbjct: 19 IDFHPTEPWVLTTLY-SGRVELWNYETQVEVRSIQVTETPVRAGKFIAR------KNWII 71 Query: 70 TAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGT 114 DD IR F+ +G+ V AH D + S+AV P Y+LSG+ Sbjct: 72 VGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGS 116
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.95
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.94
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.94
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.93
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.93
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.93
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.93
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.93
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.93
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.92
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.92
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.92
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.92
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.92
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.92
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.92
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.92
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.92
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.92
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.92
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.92
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.91
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.91
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.91
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.91
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.91
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.91
2pm7_B 297 Protein transport protein SEC13, protein transport 99.91
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.91
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.9
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.9
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.9
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.9
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.9
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.9
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.89
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.89
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.89
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.89
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.89
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.89
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.89
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.89
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.88
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.88
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.88
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.88
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.88
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.88
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.88
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.88
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.88
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.88
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.88
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.88
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.88
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.88
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.88
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.88
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.87
2pm7_B297 Protein transport protein SEC13, protein transport 99.87
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.87
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.87
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.87
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.87
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.87
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.87
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.86
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.86
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.86
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.86
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.86
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.86
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.86
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.86
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.86
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.86
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.86
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.86
3jro_A 753 Fusion protein of protein transport protein SEC13 99.85
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.85
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.85
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.85
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.85
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.85
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.84
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.84
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.84
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.84
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.84
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.84
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.84
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.84
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.84
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.84
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.83
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.83
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.83
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.83
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.83
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.83
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.83
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.82
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.82
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.82
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.82
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.82
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.81
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.81
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.81
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.8
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.8
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.8
3jro_A 753 Fusion protein of protein transport protein SEC13 99.8
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.8
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.78
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.77
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.76
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.76
2w18_A 356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.76
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.75
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.74
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.74
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.72
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.7
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.7
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.69
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.66
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.65
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.62
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.59
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.58
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.57
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.57
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.57
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 99.56
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.56
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.53
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.53
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.53
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.53
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.53
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.52
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.52
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.52
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.51
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.51
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.49
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.48
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.47
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.47
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.47
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.46
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.45
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.45
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.45
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.44
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.43
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.42
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.4
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.38
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.37
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 99.36
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.36
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.36
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.32
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.31
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.31
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.27
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.26
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.25
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.24
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.23
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.22
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.21
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.2
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.2
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.19
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.18
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 99.18
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.15
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.14
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.12
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 99.12
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 99.11
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.07
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.06
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.04
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 99.02
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.99
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.99
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 98.98
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.98
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.98
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.95
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.94
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.94
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.93
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.91
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 98.85
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 98.84
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 98.83
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.81
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.81
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 98.81
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 98.75
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.74
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.71
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.7
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.68
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 98.64
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.63
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 98.61
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.59
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.59
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.58
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.58
2qe8_A343 Uncharacterized protein; structural genomics, join 98.56
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.54
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.53
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.51
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.49
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.46
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.44
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.41
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.41
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.37
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.36
2ece_A 462 462AA long hypothetical selenium-binding protein; 98.36
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.34
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.27
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 98.25
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.23
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 98.14
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.08
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.04
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.01
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.98
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.9
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.87
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.87
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.87
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.83
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.81
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.78
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.72
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.72
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.71
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.67
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.67
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.66
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.66
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 97.65
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 97.62
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.58
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.53
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 97.52
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.43
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.41
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.41
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.39
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 97.39
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 97.38
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.37
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.36
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 97.32
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.29
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.29
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.26
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.22
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 97.19
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.19
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 97.18
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.16
3kya_A 496 Putative phosphatase; structural genomics, joint c 97.13
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.12
2p4o_A 306 Hypothetical protein; putative lactonase, structur 97.12
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.09
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.05
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.03
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.0
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.99
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 96.98
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.96
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.92
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 96.91
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.88
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.84
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.81
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.63
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.6
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.56
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.55
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.54
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.45
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.1
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 95.86
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.81
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.75
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 95.63
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.38
3kya_A 496 Putative phosphatase; structural genomics, joint c 95.31
2xzh_A 365 Clathrin heavy chain 1; endocytosis, endocytosis i 94.89
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.62
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 94.17
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 94.1
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 94.05
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 94.04
3sre_A 355 PON1, serum paraoxonase; directed evolution, 6-bla 94.03
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 93.41
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.26
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 92.98
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 92.87
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 92.64
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 92.02
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.99
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 91.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 91.34
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 91.17
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 91.1
2xbg_A 327 YCF48-like protein; photosynthesis, photosystem II 90.55
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 90.34
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 90.31
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 89.98
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 89.81
3v9f_A 781 Two-component system sensor histidine kinase/RESP 89.72
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.55
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 89.48
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 89.37
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 89.28
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 88.44
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 88.35
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 88.19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 88.13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 88.11
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 87.68
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 86.48
3q6k_A 381 43.2 kDa salivary protein; beta propeller, binding 86.0
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 85.29
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 84.91
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 84.83
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 84.82
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 83.74
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 83.49
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 83.14
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 81.53
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 80.47
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=99.95  E-value=1.5e-25  Score=131.56  Aligned_cols=107  Identities=26%  Similarity=0.321  Sum_probs=101.5

Q ss_pred             CCCCceEEEEccCCCcEEEEeeCCCeEEEEECCCCceeEEEecCCcCcCCCCceeEEEEcCCCCEEEEEeCCCeEEEEEC
Q psy17133          3 YNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDN   82 (116)
Q Consensus         3 ~~~~v~~~~~~~~~~~~l~~~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~d~~i~~~~~   82 (116)
                      |.+.|.+++|+| +++++++++.|+.|++||+.+++.+..+..+      ...+.+++|+|+++++++++.|+.|++||+
T Consensus        12 h~~~V~~~~fsp-~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~------~~~v~~~~~~~~~~~l~s~s~d~~i~vwd~   84 (304)
T 2ynn_A           12 RSDRVKGIDFHP-TEPWVLTTLYSGRVELWNYETQVEVRSIQVT------ETPVRAGKFIARKNWIIVGSDDFRIRVFNY   84 (304)
T ss_dssp             ECSCEEEEEECS-SSSEEEEEETTSEEEEEETTTTEEEEEEECC------SSCEEEEEEEGGGTEEEEEETTSEEEEEET
T ss_pred             CCCceEEEEECC-CCCEEEEEcCCCcEEEEECCCCceeEEeecc------CCcEEEEEEeCCCCEEEEECCCCEEEEEEC
Confidence            678999999999 8899999999999999999999989999888      678999999999999999999999999999


Q ss_pred             CCCeEEEEeecccccEEEEEECCCCcEEEeeecC
Q psy17133         83 VSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ  116 (116)
Q Consensus        83 ~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~s~d  116 (116)
                      .+++.+..+.+|...|.+++|+|++++|++++.|
T Consensus        85 ~~~~~~~~~~~h~~~v~~~~~~~~~~~l~sgs~D  118 (304)
T 2ynn_A           85 NTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDD  118 (304)
T ss_dssp             TTCCEEEEEECCSSCEEEEEECSSSSEEEEEETT
T ss_pred             CCCcEEEEEeCCCCcEEEEEEcCCCCEEEEECCC
Confidence            9999999999999999999999999999999976



>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 116
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-07
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-11
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.002
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-05
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-05
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-05
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.001
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-04
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 55.9 bits (133), Expect = 4e-11
 Identities = 16/113 (14%), Positives = 40/113 (35%), Gaps = 5/113 (4%)

Query: 3   YNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCH 62
           +     +I F  + +     + D +  +       + +     +        GI  V   
Sbjct: 225 HESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIIC-----GITSVSFS 279

Query: 63  PTLPLTITAHDDRHIRFFDNVSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTY 115
            +  L +  +DD +   +D +       +  H + V+ L V   G+ + +G++
Sbjct: 280 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSW 332


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.92
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.9
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.89
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.89
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.89
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.89
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.89
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.89
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.89
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.87
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.85
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.85
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.85
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.83
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.82
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.82
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.81
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.81
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.8
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.78
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.75
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.72
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.72
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.71
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.69
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.67
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.65
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.64
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.62
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.62
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.61
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.56
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.52
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.52
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.5
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.5
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.48
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.47
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 99.37
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.35
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.3
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.29
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.26
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.26
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.23
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.0
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.71
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.69
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.68
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.65
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 98.64
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.6
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.58
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.57
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.56
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.49
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.37
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.33
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.26
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.26
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.24
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.19
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.08
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.95
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.91
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.87
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.65
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.53
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.05
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 96.86
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.75
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.51
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.48
d1npea_ 263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.33
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 96.21
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.17
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.05
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.82
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.76
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.25
d1utca2 327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.54
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 93.69
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.1
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.87
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.12
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 90.93
d1ijqa1 266 Low density lipoprotein (LDL) receptor {Human (Hom 89.91
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.9
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 89.53
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 89.12
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 89.02
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.93
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.91
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 87.61
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 82.56
d2ebsa1 427 Oligoxyloglucan reducing end-specific cellobiohydr 82.19
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 80.02
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.93  E-value=4.3e-24  Score=124.16  Aligned_cols=109  Identities=20%  Similarity=0.356  Sum_probs=98.9

Q ss_pred             CCCCceEEEEccCCCcEEEEeeCCCeEEEEECCCCceeEEEecCCcCcCCCCceeEEEEcCCCCEEEEEeCCCeEEEEEC
Q psy17133          3 YNGTPTSIDFVRDESTKMVTAFDNSACVLFDLETGKPVVRIDSSQFGVSGGGGINRVVCHPTLPLTITAHDDRHIRFFDN   82 (116)
Q Consensus         3 ~~~~v~~~~~~~~~~~~l~~~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~d~~i~~~~~   82 (116)
                      |.+.|.+++|+| +++++++++.|+.+++|+....+....+.....    ...+..++|+|+++++++++.|+.|++||+
T Consensus       225 h~~~i~~v~~~p-~~~~l~s~s~d~~i~~~~~~~~~~~~~~~~~~~----~~~i~~~~~s~~~~~l~~g~~dg~i~iwd~  299 (340)
T d1tbga_         225 HESDINAICFFP-NGNAFATGSDDATCRLFDLRADQELMTYSHDNI----ICGITSVSFSKSGRLLLAGYDDFNCNVWDA  299 (340)
T ss_dssp             CSSCEEEEEECT-TSSEEEEEETTSCEEEEETTTTEEEEEECCTTC----CSCEEEEEECSSSCEEEEEETTSCEEEEET
T ss_pred             CCCCeEEEEECC-CCCEEEEEeCCCeEEEEeecccccccccccccc----cCceEEEEECCCCCEEEEEECCCEEEEEEC
Confidence            678899999999 889999999999999999998887776654422    467999999999999999999999999999


Q ss_pred             CCCeEEEEeecccccEEEEEECCCCcEEEeeecC
Q psy17133         83 VSGKLVHSMVAHLDAVTSLAVDPQGLYILSGTYQ  116 (116)
Q Consensus        83 ~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~s~d  116 (116)
                      .+++.+..+.+|...|.+++|+|++++|++++.|
T Consensus       300 ~~~~~~~~~~~H~~~V~~l~~s~d~~~l~s~s~D  333 (340)
T d1tbga_         300 LKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWD  333 (340)
T ss_dssp             TTCCEEEEECCCSSCEEEEEECTTSSCEEEEETT
T ss_pred             CCCcEEEEEcCCCCCEEEEEEeCCCCEEEEEccC
Confidence            9999999999999999999999999999999976



>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure