Diaphorina citri psyllid: psy17138

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--

NLIVSAETQGGGVKVNELRVANSLKPLDVVSVPLLPSDGKVDEQEEDKLSSSNLRMRELGTLRKPVQPKPHLSPYPYIIGLTGGIASGKSTIAKYLETLGAGLINCDQLGHRAYDVGTRGNQVVRELFGEDIALPDGSIDRKKLGAIVFSNKDEMNKLNQAIWPLILAQVKEEIARLSESHKVIVIEAAVLLSAKWQDQVHEIWVTFIPEQE

ccEEEccccccHHHHHHHHHHcccccccEEEEcccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEECccccccHHHHHHHHHHccccEECHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEEEEEcHHHcccccccccEEEEEEEcccc

NLIVSAETQGGGVKVNELRVANSLKPLDVVSVPLLPS*****************RMRELGTLRKP******LSPYPYIIGLTGGIASGKSTIAKYLETLGAGLINCDQLGHRAYDVGTRGNQVVRELFGEDIALPDGSIDRKKLGAIVFSNKDEMNKLNQAIWPLILAQVKEEIARLSESHKVIVIEAAVLLSAKWQDQVHEIWVTFIPEQ*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dephospho-CoA kinase	Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A.	confident	Q49YB9
Dephospho-CoA kinase	Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A.	confident	Q3MGH8
Dephospho-CoA kinase	Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A.	confident	Q92BF2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004140 [MF]	dephospho-CoA kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F6R, chain A
Confidence level:very confident
Coverage over the Query: 28-39,57-211
View the alignment between query and template
View the model in PyMOL