Diaphorina citri psyllid: psy1713

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------

SNDIHSNINSICSTYSKSKLSLNNVSSPPSNERKSLSSKDSSSNGNSKCLLPKPKEILYSPNKITLGWQGRVPAGAGLVNAINTCYLNSCLQALFHIPSFHNWLLNDTEHQTLCEKQSGYQFECLVCAMRKTLAHCQAKSGSAIRPELIIKKLKLIARHLEHHRQEDSHEFLTYLIEGIQKSYLKAIPSSNKLDSASKETTPIYQLFGTYLRTEVTCNSCSHISTQCLFHSRLDSASKETTPIYQLFGTYLRTEVTCNSCSHISNLELSLDIRQSSSLDEALGHFFAKEYLGGDNLYRCEKCGRKVEATKRFSVDKPPNVLRLQLKRFNYHGLKNSRSVQVPLHLEFGKFMHCRMSHSQLKYKLVSAVIHHGSSPDSGHYTCIGSTSSGSYHYFDDE

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHccccccccCEEccccccccccccccccccccccccccEEccccECccEEEEccccccccCECcccccccccHHHHHHHcccccccccccccccccccccCEEEEEEEEEccccEEEEEEcccccccccccEEEccccccccccccccccccccccEEEEEEEEECccccccccEEEEEEcccccEEEcccc

******************************************************KEILYSPNKITLGWQGRVPAGAGLVNAINTCYLNSCLQALFHIPSFHNWLLNDTEHQTLCEKQSGYQFECLVCAMRKTLAHCQAKSGSAIRPELIIKKLKLIARHLEHHRQEDSHEFLTYLIEGIQKSYLKAI************TTPIYQLFGTYLRTEVTCNSCSHISTQCLFHSRLDSASKETTPIYQLFGTYLRTEVTCNSCSHISNLELSLDIRQSSSLDEALGHFFAKEYLGGDNLYRCEKCGRKVEATKRFSVDKPPNVLRLQLKRFNYHGLKNSRSVQVPLHLEFGKFMHCRMSHSQLKYKLVSAVIHHGSSPDSGHYTCIGSTSSGSYHYFDDE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable ubiquitin carboxyl-terminal hydrolase 16		confident	O74442
Probable ubiquitin carboxyl-terminal hydrolase 46		confident	P34547

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004843 [MF]	ubiquitin-specific protease activity	probable	GO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044297 [CC]	cell body	probable	GO:0005575, GO:0044464, GO:0005623
GO:0016579 [BP]	protein deubiquitination	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GFO, chain A
Confidence level:very confident
Coverage over the Query: 70-226,244-247,267-397
View the alignment between query and template
View the model in PyMOL

Template: 3MTN, chain A
Confidence level:probable
Coverage over the Query: 77-186,215-396
View the alignment between query and template
View the model in PyMOL